SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|232036|sp|P29693| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|232036|sp|P29693|
Domain Number 1 Region: 177-265
Classification Level Classification E-value
Superfamily eEF-1beta-like 1.57e-36
Family eEF-1beta-like 0.00000446
Further Details:      
 
Weak hits

Sequence:  gi|232036|sp|P29693|
Domain Number - Region: 57-97
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00235
Family N-terminal coiled coil domain from apc 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|232036|sp|P29693|
Sequence length 265
Comment RecName: Full=Elongation factor 1-delta; Short=EF-1-delta; AltName: Full=P36
Sequence
MSAFVITTEQVWLDKYKYDDAEKQYYENLSMGSASNKPHNSPQSAASALSNSGDGSELAA
RVANLEQENQSLHKVVKDLQSAISKLESRLSTLEKSSKSQKPAAASQPAIEVAARVQKVQ
VTPAAKEENGTGEDDDDDDDIDLFGSDNEEEDAEAARIREERLKQYAEKKSKKPGVIAKS
SILLDVKPWDDETDMAKLEECVRTVQMDGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGT
DILEEEITKFEDYVQSVDIAAFNKI
Download sequence
Identical sequences P29693
NP_001081523.1.7800 gi|147905071|ref|NP_001081523| gi|232036|sp|P29693| gi|64668|gb|CAA47313|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]