SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240849382|ref|NP_001155366| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240849382|ref|NP_001155366|
Domain Number 1 Region: 852-934
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-21
Family DEATH domain, DD 0.000012
Further Details:      
 
Domain Number 2 Region: 158-248
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 248-300
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 302-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000746
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 5 Region: 51-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000218
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240849382|ref|NP_001155366|
Sequence length 942
Comment unc-5-like protein B [Xenopus laevis]
Sequence
MYLSRIPGGAALAALLVALLLCCNFPPSIAGIEYSDVLPDSFPSAPAESLPHFLLEPEDA
YIVKNKAVELVCKANPATQIYFKCNGEWVNQNDHITKERVDDVTGLVVREVQIEVSRQQV
EELFGLEDFWCQCVAWSSAGTTKSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPP
EGVPPAEVEWLKNEEIIDSTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRST
TATVIVFVNGGWSSWTEWSPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNT
MCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLCMQNK
RVLGETKSHLLESTGDVALYAGLVVAIFIIIILLMAVGIVVYRRNCREFDTDITDSSAAL
TGGFHPVNFKTSRHDNSHLIHPAMQPDLTANAGIYRGHMYALQDSADKIPMTNSPLLDPL
PNLKIKVYNSSTVGSSPGIHDGNDLLGAKPTGTYPSDNIMNARNKNMSTQHLLTLPRDSS
NSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILS
PIITCGPTGLLLCKPVILTVPHCADITTSDWILQLKTQSHQGNWEEVVTLNEETLNTPCY
CQLESHSCHILLDQLGTYAFVGESYSRSAIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPD
ALKEVLELEKTLGGYLIEEPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHV
WSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENVKSFDPFCSHA
ENSVTTQLGPYAFKIPFLIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPT
GVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATDGDC
Download sequence
Identical sequences C5IAW9
NP_001155366.1.7800 gi|238915923|gb|ACR78433| gi|240849382|ref|NP_001155366|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]