SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|2494699|sp|Q91754| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|2494699|sp|Q91754|
Domain Number 1 Region: 291-528
Classification Level Classification E-value
Superfamily SIS domain 1.22e-18
Family mono-SIS domain 0.0043
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily SIS domain 0.0000000016
Family mono-SIS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|2494699|sp|Q91754|
Sequence length 619
Comment RecName: Full=Glucokinase regulatory protein; Short=Glucokinase regulator
Sequence
MRGTRKYQHVIETPDPGKWELAGYEESLPISEKSNPMTRELDKADPSQLVQLLRDCDAEI
FQEEDENLIHYHRLYSESVLKTMGDVAKRVQEVLKNPDDSLVVLSGCGTSGRLALLLANS
FNGLLKGLHKTPCYCYIMSGGDRSIVTSQESSEDNPQLGAQELEKVCEGKKNVLFIGISC
GLSAPFIAGQLDFCMRHLDVYLPVLVGFNPVSMARNERIEGWHSSFRQVAERLQTLHDSQ
KGFILNPAVGPEGVSGSSRMKGGSATKILLETLLLVAHKAESNVPVTEKCLLEILRTYER
AHKVTYSQSKKIAALMKQTATSLQKKGHLYILGWGTLGLVGIMDAVECVPTYQADWRDVR
GFITGGYHSIENKEGDLSSLGPQFSISHEDFVKNVLPSVSETDTVLLIFTLDDDLNQIEK
LVALVKEKTSNIQVICHATAGQYLPNSLKKTIPSIIGLTWPILFLEYEGAFIQKFQRELS
TKWILDTVTSGAYTLRGKIFRNFMVDFKINNSKLFHRATSVLQRLTGQSHQRCTEVLLQS
IYGEQTLSEQIRNTTIAGHVEAAASQDKVLPVAIVSLLRSCTIQDSRSRINSSLSIRSAI
ESSMNVPGRKRGAEDSESR
Download sequence
Identical sequences Q91754
gi|2494699|sp|Q91754| gi|556678|gb|CAA56863|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]