SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27696880|gb|AAH43783| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27696880|gb|AAH43783|
Domain Number 1 Region: 242-511
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-82
Family Protein kinases, catalytic subunit 0.000000000566
Further Details:      
 
Domain Number 2 Region: 129-273
Classification Level Classification E-value
Superfamily SH2 domain 1.37e-38
Family SH2 domain 0.00000899
Further Details:      
 
Domain Number 3 Region: 67-139
Classification Level Classification E-value
Superfamily SH3-domain 3.21e-24
Family SH3-domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27696880|gb|AAH43783|
Sequence length 519
Comment MGC53012 protein [Xenopus laevis]
Sequence
MGCKQCKEDEVAKAEESALENPQRYCPDPTSQMPFRTQETHTPFINTGIGGVMSGPSHRG
MGVGVTAGATLFIALYDYDARTEDDLTFQKGEKFHIINNSEGDWWEARSLSSGNTGYIPS
NYVAPMNSIQSKDWFFGKIGRKDAERLLLSEGNPRGTFMIRESETTKGAYSLSVRDWDAS
RGDHAKHYKIRKLDSGGFYITTRVQFNTVEELVEHYGEFNDGLCHLLTSPCINQKPQTLG
LAKDAWEITRDSISLDKKLGQGCFGDVWKGTWNGTTNVAVKTLKPGTMSPEAFLEEAQIM
KKLRHDKLVQLYAVVSEEPIYIVTEFMTKGSLLDYLKDGEGHFLKLPQLVDMSAQIASGM
AYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAA
LYGRFTIKSDVWSFGIMVCELVTKGRIPYPGMSNREVLEQVERGYRMPAPPGCPPSLHEL
KLQCWRGDPEERPTFEYLQSFLEDYFTATEPQYQPGDNI
Download sequence
Identical sequences A0A1L8HEA3
gi|148223327|ref|NP_001079482| gi|27696880|gb|AAH43783| XP_018101913.1.7800 XP_018101914.1.7800 XP_018101915.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]