SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28278291|gb|AAH46260| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28278291|gb|AAH46260|
Domain Number 1 Region: 178-300
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.57e-58
Family Dystroglycan, domain 2 0.000000725
Further Details:      
 
Domain Number 2 Region: 485-586
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000942
Family Dystroglycan, N-terminal domain 0.05
Further Details:      
 
Domain Number 3 Region: 62-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000377
Family Dystroglycan, N-terminal domain 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28278291|gb|AAH46260|
Sequence length 886
Comment Dag1-prov protein [Xenopus laevis]
Sequence
MDIRCAALSFPMLRTIMVLLMASSAWSVWPSDPTEVAQDWDNQLEASMHSLFPEIKETVA
PMAGIPDSSAVVGRPFKIHIPAEFLASNGETIKISEVGKDTLPSWLHWEANFLQGLPLDG
DKGVYEISVASLQLAPNGSYVPQTTDVFSVEVHPEDHNEPQSVRVAGQETTEATPFLCGT
DEPVTILTVILDADLTKMTTKQRVDLLNRMRDFSEVELFHMKLVPVVNNRLFDMSAFMAG
PGNAKKVVENGALLSWKLGCGMDQNTVPNIRSVEVPAKEGTMSAQLGYPVVGWHIANKKP
QMPKRIRRQIYATPTPVTAIGPPTTAIHEPPERIVPTPTSPAIAPPTDTTAPPVREPIPL
PGKPTVTIRTRGAIIHTPTLGPIHPTRIIETTSIVRPTMTRPIYVEPTAAVTPPSTTTKR
PRVTTIKSATPPTTDSSTTTTKKPTKKPRPRPPKPLATTKAPTTKVETTSTTRPRTSTSG
VPNTDPELKNHIDKVVAWVGTYFEVKIPPDTFYDREDGTTDNLQLTLVPRIKASTGEKMW
VMLNSTSQVMYGMPDYIHIGDHEYYLRAADKAGRTAVDALEIQVRNLFQKQPSPVKFHAK
FHGDHNAVINDINKKILLVKKLAFAFGDRNSSSITLHNITKGSVVVDWTNNTFPTEPCPV
EQVEGVGKKIYDERGNPRQHFVNAVEPEFKLLNISLSFTGSCKHKNFRYIPMRPEEPIPT
AVAPTLAEERNPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIEDQA
TFIKKGVPIIFADELDDSKPPPSSSMPLILKEEKAPLPPPEYPNQNVPETIPLNQDTFGE
YMPLRDEDPNAPPYQPPPPFTTPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q7ZX16
NP_001080755.1.7800 gi|148232988|ref|NP_001080755| gi|28278291|gb|AAH46260|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]