SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301171270|ref|NP_001180332| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301171270|ref|NP_001180332|
Domain Number 1 Region: 21-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-31
Family PDI-like 0.034
Further Details:      
 
Domain Number 2 Region: 142-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.61e-18
Family Calsequestrin 0.034
Further Details:      
 
Domain Number 3 Region: 240-368
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-17
Family PDI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301171270|ref|NP_001180332|
Sequence length 406
Comment endoplasmic reticulum protein 44 [Xenopus laevis]
Sequence
MRRYSFVPYFYPAYFFMLLIMCVFTPVKSEIITLESGNIDDILRNADVALVNFYADWCRF
SQMLHPIFEEASNIIQEEYPDKNKVVFARVDCDQHSEIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVTAIADYIRQQKSNPIREVGDLEELKTVDRSKRNIIGFFESKETDNFRTFEK
VSNILHDDCVFLAAFGDVAKPERFSGDNVIYRPIGENAPDMVYLGSLTNFDLTFAWTQDK
CVPLVREITFENGEELTEEGLPFLILFHVKDDTASLEKFQQEVARQLISEKGTINFLHAD
CEKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFKDLSISGKLKQFILDLHSGKLHREF
HHGPDPTDVSPDQPTEDISNPPDSSFQKLAPSEHRYTILNRDRDEL
Download sequence
Identical sequences Q3B8B4
NP_001180332.1.7800 gi|301171270|ref|NP_001180332| gi|77748396|gb|AAI06630|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]