SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32822847|gb|AAH54954| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32822847|gb|AAH54954|
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.72e-36
Family PDI-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 361-471
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-31
Family PDI-like 0.0008
Further Details:      
 
Domain Number 3 Region: 232-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-27
Family PDI-like 0.021
Further Details:      
 
Domain Number 4 Region: 139-235
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-22
Family PDI-like 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32822847|gb|AAH54954|
Sequence length 505
Comment MGC64309 protein [Xenopus laevis]
Sequence
MMRARFVFCCTLLVVARADILEEQDVLVLKKDNFDEALKQNQFILVEFYAPWCGHCKALA
PEYEKAAGILKSEGLSIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKSSPKEYSAGR
EAADIVNWLKKRTGPAASVLSDEAAVAALVDSSEVAVIGFFKDPESELAKVFLKAAEAVD
DIPFGITSSDAAFSKHELSKDGIVVFKKFDEGRNTFEGENTKEELLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSAMDYKDKLENFKKAAESFKGKILFIFIDSDHIDNQR
ILEFFGLKKEECPTVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDV
PEDWDKNPVKVLVGKNFEEVAFDEEKNVLVEFYAPWCGHCKQLAPIWDQLGEKYKNHDSI
IIAKMDSTVNEIEAVKIHSFPTLKFFPAGPGKVADYNGERTLEGFSKFLESGGQDGAADE
DLEDLEDADETDLEEGDEVHTKDEL
Download sequence
Identical sequences Q7SY98
gi|147907094|ref|NP_001079815| gi|32822847|gb|AAH54954| NP_001079815.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]