SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34391897|gb|AAP43996| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34391897|gb|AAP43996|
Domain Number 1 Region: 358-546
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.19e-64
Family Regulator of G-protein signaling, RGS 0.00001
Further Details:      
 
Domain Number 2 Region: 751-979
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-59
Family DBL homology domain (DH-domain) 0.0000000118
Further Details:      
 
Domain Number 3 Region: 981-1114
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-38
Family Pleckstrin-homology domain (PH domain) 0.00001
Further Details:      
 
Domain Number 4 Region: 71-150
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-21
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|34391897|gb|AAP43996|
Sequence length 1450
Comment guanine nucleotide exchange factor [Xenopus laevis]
Sequence
MSGTQSAASDRFHSRKPTRHGSILYRESSTDKKQKVERSVSSSHDFDATESVSRKAKSTW
DESRQETYGLVQRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVN
GTLVTHSNHLEVVKLIKSGSYVALTVQGRPLGSPTIPLTDSEADNFVPIMPPHSPVPQGH
GKGITSPILMEEENNIVHTQKLDILMKMLQKEQDQLHQFQEEFHTTPSQRLSKEIQDSKK
HIAQLQDGLSKARGLSQGSESLQISELDADSSDILGQTDCSSGDGSRPNSDIVDSPRSGQ
RDKSFLEESLEKSEIQDTDSQSSMGSPSIRFTHNIIGAEDDDFDAEPEQSPQINGQCSCF
QNMDLLKSHPAHLAVFIHHVVSQFDPAALLCYLHADLYQQTNSKETRRVFMEFNQFFLER
AANLKVPVPDDVALELEKRRPELIPEELHRQYIQTVQERLSEDVKKNLEDFKQKRSMGLT
LAEGELSKLDTERFRDRNTIDKERACAEQIVQKIEEILFTSQTPEDEKSNTIQYVILTYM
KHLGVKVKEPRSLEQKRGRIGFLPKIKQSMKKDREGEEKVKRRGFPSILAPQRKPSRQDS
NAIGKAMELQRQRHPKHLSTSSSSSPEPADGSRLRTSGGSIEGSDTPFSPSSNLGAAYTF
QEVGREVEGVSRCGGENMSSVDTLDGGTRTSGPIFDFPSPSLDHLHEEIGEADRLTDLGT
PKLLRKLDSVALSDIQSEDEHHEIDQEEHPPNWQQLVSKDTLQKLKPHEIKQQEVINELF
CTERAHVQKLSVLDQVFHQRVIRENLLTPAETRNIFSNLEEILQLHGALNEQMKAVKKRY
ETSVVEEIGDYVLNWFSGAEEEKLKQAVATFCSNQPFALEMIKSRQKKDLKFLAFVQDAE
SNPLCKRLQLKDIIPTEMQRLTKYPLLLDNIARYSDQEDEKEKVNKAANHCRNILDYVNQ
AVKEAENKQRLEDYQRRLDLSCLKPGEYPMIDELRNLDLTKRKLIHEGPLTWKVNKDKSI
DLYSLLLEDILVLLQRQDDKFNSEMRKQDLAATSESKHIFSPVIKLNTVLVRQVATDNKA
FFVISMSENGAQIYELMANSVSEKNGWQDLITSMAATSKTENSQPAQLQQTDPDLDSEEE
HEDQLKLSNDKEDERLLHRHRTDKDTESLVQPKSFSPSPTHGSILPHHAGILKDQNQQDF
RCSTSPSSCHPSTEHHLAVHALRNLGLLKQLLEQQLKFLQKEEEENFQRFCSHKTKEQNL
TRVSSLNKQNRGSRESDLNKDLHALHRAIDKGSEHGNTGPDCVAEILEESGEQFFDAQEP
HSDIYVDGSRREKHIEEAQFRSSENYLILDGYENVPESSTDDDLSASHYSNQGDPNDSLH
GEERLAFNALEPASSSEAFDQMLHYIETIESDLQQLKGLEDHYITYRNRVALSGVLEEDP
DKAMLPTDKG
Download sequence
Identical sequences Q6XS95
gi|148223173|ref|NP_001082763| gi|34391897|gb|AAP43996| NP_001082763.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]