SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46811889|gb|AAT02188| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46811889|gb|AAT02188|
Domain Number 1 Region: 103-131,175-252
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000341
Family Glutathione S-transferase (GST), C-terminal domain 0.043
Further Details:      
 
Domain Number 2 Region: 41-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000573
Family Glutathione S-transferase (GST), N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46811889|gb|AAT02188|
Sequence length 274
Comment metaxin 2 [Xenopus laevis]
Sequence
MSLVTDAFVSQIAAVEPWPGNAALYQPMKSEQVLLSDNASCLAVQAFLKMCNLPVQVVCR
ANAEYMSPSGKVPFIHVGNQVISELGPIVQFVKAKGHSLSDGLDEVQRAEMKAYMELVNN
MLLTAELYIQWCDEATLEEITQPRYSYPYSWPLNYFLVFQRKWEIKRKMKAIGWATKTLE
QVFEDVDQCCQALSQRLGTQSYFFNKQPTELDALVFGHLFTILTTQLTNDELQEKVKNYS
NLIAFCRRIEQHYFEDHDGSISSSIKLSKGPTLP
Download sequence
Identical sequences Q6Q8B0
NP_001084472.1.7800 gi|148233072|ref|NP_001084472| gi|46811889|gb|AAT02188|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]