SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47122966|gb|AAH70632| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47122966|gb|AAH70632|
Domain Number 1 Region: 123-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.32e-29
Family PDI-like 0.016
Further Details:      
 
Domain Number 2 Region: 35-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-27
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 3 Region: 448-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.58e-27
Family PDI-like 0.0074
Further Details:      
 
Domain Number 4 Region: 555-669
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.15e-26
Family PDI-like 0.015
Further Details:      
 
Domain Number 5 Region: 673-780
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-26
Family Thioltransferase 0.056
Further Details:      
 
Domain Number 6 Region: 351-463
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000107
Family PDI-like 0.04
Further Details:      
 
Domain Number 7 Region: 231-350
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000792
Family PDI-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|47122966|gb|AAH70632|
Sequence length 796
Comment MGC81459 protein [Xenopus laevis]
Sequence
MKHSLNTATSSSSVLKRTILYLVLISLAALVYCDDDYYDLLGVSKAATNREIRQAFKKLA
LKLHPDKNKDPDAHNKFLKINRAYEVLKDEDLRKKYDKYGEKGLDEQNQGGGYQSWSYYR
YDFGIYDDDLEIITLDRGEFDGAVNSGELWFINFYSPGCSHCHDLAPTWRQFAKEMDGLL
RIGAVNCGDNRMLCRSQGINSYPNLYIFKSGMNPVKYYGERSKERLVNFAMPYISSTVTE
LWAGNFRSSIEDAFSSGVGWLITFCSDTGDCLNSQTRSKLAGLLEGLVKVGWMDCATQGD
LCDNLEITSSATVYFPPGSTLTDKENGDVLFLNSLDAREIYKEVLNHLPDLETISPESLQ
GKLSHHRWLLFFTFGTDEQSSLPEFKKLTVHLRSEHVQVGKFDCYSSPSICSELYIHKPC
VAAFKGKGISAYEIHHGKVQLYDLVSFAKESVNSHVITLGPTNFPGKDRDTWLVDFFAPW
CPPCRALLPELRIASKRLFGQIKFGTLDCTIHEGLCNMHNIRAYPTTVVFNHSNIHEYAG
HNNAEEILEFIEDLRNPSVVTLTPETFQSLVRNRRGDEMWMVDFYAPWCGPCQALMPEWK
RMARHINGLISVGSIDCQKYSLFCTQERVNGYPEIRLYPANINPQHTYYRYTGWHRDSQS
LRNWALMYLPKASFDLTPESFHEHVINGKDNWVLDFYAPWCGPCQNFNPEFEILARAVKG
KIKAGKVNCQAYEHLCNSASIRSYPTVRLYPYNGSKKKDYFGEQIDSRDAKEIAQIITKR
IEAIKRVKEAYNKDEL
Download sequence
Identical sequences Q6NRT6
gi|147907399|ref|NP_001084933| gi|47122966|gb|AAH70632| gi|82185288|sp|Q6NRT6| NP_001084933.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]