SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49115606|gb|AAH73500| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49115606|gb|AAH73500|
Domain Number 1 Region: 178-300
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.01e-59
Family Dystroglycan, domain 2 0.000000725
Further Details:      
 
Domain Number 2 Region: 485-586
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000173
Family Dystroglycan, N-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 62-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000188
Family Dystroglycan, N-terminal domain 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49115606|gb|AAH73500|
Sequence length 886
Comment LOC398500 protein [Xenopus laevis]
Sequence
MDIRCAGLSLPMLRTIMVLLMASCAWSAWPSDPTEVAQDWDNQLEASMHSLFPEIKETVA
PMTGIPDSSALVGRPFKIHIPTEFLASSGETIKISEVGKETLPSWLHWEGNFLQGLPLDG
DKGVYDISVASLHLAPNGSYVPHTTDVFSVEVHPEDHNEPQSVRVAGQETAEAIPFLCGT
DEPVTLLTVILDADLTKMTPKQRVDLLNRMRDFSEVELFHMKLVPVVNNRLFDMSAFMAG
PGNAKKVVENGALLSWKLGCGMDQNTVPNISSVEVPAKEGTMSAQLGYPVVGWHIANKKP
QMPKRIRRQIYATPTPVTAIGPPTTAIHEPPERIVPTPTSPAIAPPTDTTAPPVREPIPL
PGKPTVTIRTRGAIIHTPTLGPIHPTRIIETTSIVRPTMTRPIYVEPTAAVTPPSTTTKR
PRVTTMKPATPPTTDSSTTTTKKPTRKPRTRPPKPLATTKAPATKFETTSSSRTRTSTSG
VPNTDPELKNHIDKVVAWVGTYFEVKIPPDTFYDREDGTTDNLQLTLVPRIKASAGEKMW
VMLNSTSQVMYGMPDYIHIGDHEYYLKAADKAGRTAVDALEIQVRNLFQKQPSPVKFHAK
FHGDHNSVINDINKKILLVKKLAFAFGDRNSSSITLHNITKGSVVVDWTNNTFPTEPCPV
EQVESVGKKIYDERGSPRQHFVNSVEPEYKLLNISLSFTGSCKHKNFRYIPMRPEEPIPT
AVAPTVAADRNPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIEDQA
TFIKKGVPIIFADELDDSKPPPSSSMPLILKEEKAPLPPPEYPNQNVPETIPLNQDSLGE
YTPLRDEDPNAPPYQPPPPFTTPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q6GNK8
NP_001082480.1.7800 gi|148232832|ref|NP_001082480| gi|49115606|gb|AAH73500|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]