SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49118677|gb|AAH73710| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49118677|gb|AAH73710|
Domain Number 1 Region: 820-999
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 974-1096
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-32
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 3 Region: 3-168
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-26
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 4 Region: 174-219,341-427
Classification Level Classification E-value
Superfamily PH domain-like 2.97e-25
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49118677|gb|AAH73710|
Sequence length 1225
Comment MGC83651 protein [Xenopus laevis]
Sequence
MERRSSADMCHPLLEVNSMPADKAPKEEKRFRLWYIGWSSLDRRTTLPMLPWLVAEIRRR
AERQDPPGCAAPCREVNLMLVTPHLRCVPAMNGANANSAVFIFEHKAQHISRFIHNSQDP
SYFAYLIKTQPDNPESEMACHVFKAGSPRQVSDIISSIRQVSKVALKEDSKPCRDSEDAF
YNSQKFEVLYCGKVVIANKKAPSTLVDDCIEKFSQHERQRLQSLTEQQSSESSIDFSLAE
IDVPGSPSDIFLEQDSENNIFPSSGHHSGIFTVGSQSNLLGSRVTFPERILEDSGFEDQQ
EFRTRCSSVTIQKRSQDNKIQPRRRHASAPSHVQPSDSEKNRTMLFQVGRFEINLISPDT
KTVELEKNFKDISSCSQGIKHIDHFGLVCRESVEPGINQYICYVFQCASEALVEEVMLTL
KQAFSTAADLQSAKTQIKLCEACPMHALHKLCERIEGLYPPRAKIVIQKQLSLLTDNEQA
DIFERVQKMKATSDQEENELVILHLRQLCETKQKTHVHIGEVQPNLSCNTIPENTAPSGR
FKLDILKNKAKKSLTSSLENIFSRGTNKMRGRLGSMDSFERCNSFTSDKDVSPGDSPPAT
PPSSPVSSSFPPFPEEDPDSPKVRRRAHTFSHPTSSGKRRITFPDSKSPSARFPLQRQNS
LANDVGQSSECEGRRRTFSTCSNDSLNASGACLTPRRISWRQRIFLRVASPMTNSPSEMQ
HKGQLDVNDLLPLSPLPPAMEEDPLAELLQTEDSVLQADGKRSAEDFQNLWKKAIHQQIL
LLRMEKENLKLEASRDELQSRKVKLDYEEVGSCQKEVSNLWDKKLNCRTKIRFDMEEIFA
SLKEGVPKGKRGEIWQFLSVQYRLRHRLPNKQQPSDVSYNDLLKQLTAQQHAILVDLGRT
FPTHPYFSAQLGAGQLSLYNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEQQAFEMLKF
LMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEITPSLYAAPWFLTLFA
SQFPLGFVARVFDIIFLQGTEVIFKVALCLLSNNEALIMARDSFESIVDLLKSTIPEMTN
ETMEKIMTQAFEMDISKQLHAYEVEYHVINDEMLEASIPCDDNESFRKLEKSNNQLKRQN
MDLLEKLQVAHTKIQSLESNVENILSRENKMRNLVLSMEEERTVYQNVFELMKKYVPTNV
LTDCEVLLKNATCSPNNRTKPGNKQ
Download sequence
Identical sequences Q6GN12
gi|147905358|ref|NP_001086020| gi|49118677|gb|AAH73710| NP_001086020.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]