SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49257380|gb|AAH73549| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49257380|gb|AAH73549|
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-29
Family PDI-like 0.0073
Further Details:      
 
Domain Number 2 Region: 230-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000016
Family PDI-like 0.062
Further Details:      
 
Weak hits

Sequence:  gi|49257380|gb|AAH73549|
Domain Number - Region: 148-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00595
Family Calsequestrin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|49257380|gb|AAH73549|
Sequence length 452
Comment Txndc10a protein [Xenopus laevis]
Sequence
MAAAGLCFILAIVSSTSLLASVPVSALVEDLDDSFKENRKDDIWLVDFYAPWCGHCKKLE
PVWNEVGIEIRTSGSPIRVGKIDATVYSSIASEFGVRGFPTIKALKGDMAYNYRGPRTKE
DIVEFANRVAGPLIRPLPSQQMFDHVKKRHPVLFVYVGVESTLKEKFIEVASELIVYTYF
FSASEDVLPKYVTLNEVPAVLVFKDSTYFVYDEYEDGDLSSWVNKERFEGYLHIDGFTLY
ELGDTGKLVAVAVIDEKNNSIEHTRIKSIAQDVAKNNRNNFHRDFQFGHMDGNDYINSLL
MDELSIPTFVVLNTSNQQYFLPSKHIENPEEMIQFINSILDGTAEAQGGDGILQRIKRVF
YDAKSTVVSVFKSSPLLGCFLFGLPLGVISIMCYGICTADTEDGSEEMTRKDVIDQNASD
EGSDEEEEKGREITDVSDEDQQEKDFMEKKID
Download sequence
Identical sequences Q6GNG3
gi|148226340|ref|NP_001085926| gi|49257380|gb|AAH73549| gi|78103210|sp|Q6GNG3| NP_001085926.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]