SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50418301|gb|AAH77351| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50418301|gb|AAH77351|
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily TPR-like 8.54e-18
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 
Domain Number 2 Region: 799-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000556
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number 3 Region: 845-877
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000089
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number 4 Region: 717-749
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000523
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|50418301|gb|AAH77351|
Domain Number - Region: 583-612
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0283
Family CCCH zinc finger 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50418301|gb|AAH77351|
Sequence length 916
Comment Zc3hdc7-prov protein [Xenopus laevis]
Sequence
MRFFLKKLVIDLYNEGNDLYREDCAKDSLSQYTEALSIAEYASSDDINIPSKTWERLYVN
RAASYLEMGLYKEALKDCEDVLKLNDCNLRALYRKSKALFMLERYTEAYDSVAKCSLSAP
QDESVVKLSQDIAVKLGLKIRKAYIRAKTSLSMASEEEGRKNVDSLAEHIEPDLPAFNSE
SPLLPFSSLAVATDSFSGTPSSSACISPSVFPIAEVGTFPSAIASNGVSSPFSITCMNYG
DGDILGDELDKFLDSVPGSNDIHKASAAVGLFPSSKQNISGSPVQNIPVFPGFSTDQYSP
SLISSFESMVLTSATVTDYQGDPSVLGQINGTSKTSISDTSSFIGKDSTYLFRPNSPDIL
GASLKISLPDSLVNGAQSISQCTLKGINPLEDTHEFRQACQFCFTKSGTSQAFVFNSGLN
HKCKKDILLGRIKSSVDASWKKIRPRPKNQYLGPFYLCKDVLQGNDCTYPNCTFAYSQEE
IDVWTQERMGTFCREALFGGKGKISLTIPHLLQEHPGTFVFLCGKCFDHKPRIISKGNMD
NPFFCSHPGLKHAFQDVKCLVHINLGVTVKYSKIRPFELNFVLDLCRHEVRYGCLREDCC
FYAHSLVELRVWVIQKETGISLDAIVQESRKSSAAESFAPRSQVLNIPTNAGNPNAKIKF
VCGQCWRNGQVIEADKNKKYCSAKARHQWSKDHRIVLVMSERKKWIAIRPYPAKKPAPLQ
FEMCNHIASGKKCQYIGNCSFAHSPEEKEIWTSMKELGLQDMEQLYEKLMKKDTVEKWDG
ASAQVNKQIHLPTDYAETTVDFHCWLCGKNCNSERQWNMHISSEKHKEKVFHCEEDQNIW
QHRFPTGKFTVCKRFLSGKCPEGEDCSFAHGNAELEEWMERTQVLRQKLLKARKDKLISP
DDNDFGKYSFLINDLN
Download sequence
Identical sequences Q6DDZ7
gi|147906220|ref|NP_001086721| gi|50418301|gb|AAH77351| NP_001086721.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]