SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50418323|gb|AAH77392| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50418323|gb|AAH77392|
Domain Number 1 Region: 114-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-45
Family Hypothetical protein AT3g04780/F7O18 27 0.0000781
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-22
Family Thioltransferase 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50418323|gb|AAH77392|
Sequence length 289
Comment MGC81675 protein [Xenopus laevis]
Sequence
MVGVKVIGADGEFQGELTAAGSRLSVVKFTMKGCPPCVRIAPAFTSLSNKYPQAIFLEVD
VHQCQGTATANNISATPTFLFFRNRVKIDQYQGADVAGLEEKIKQHLENDLGNNEDSDIP
RGYMDLLPFVNKAGCESLNESDDHGFDNCLRKDPTYLESDCDEQLLMTVAFNQPVKLYSM
KLQGPDNGQGPKYVKIFINLPRSMDFDEAMRSEPTQAVELSADDIKEDGIIPLRYVKFQN
VNSVTLFVQSNQGDEEATRITYLTFIGTPVQATNMNDFKRVIGKKGESH
Download sequence
Identical sequences Q6DDW1
NP_001086748.1.7800 gi|148230585|ref|NP_001086748| gi|50418323|gb|AAH77392|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]