SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50925315|gb|AAH79770| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50925315|gb|AAH79770|
Domain Number 1 Region: 502-612
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-24
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 316-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-16
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 618-689
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000117
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 678-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000709
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 746-804
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000834
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 262-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000862
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 7 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000249
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 8 Region: 441-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000773
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50925315|gb|AAH79770|
Sequence length 900
Comment MGC86242 protein [Xenopus laevis]
Sequence
MMPLAGIAWNLMLLFSAVQGLPLQDGEGTQHPDLLNNPPKGSVEPVALEQLVHQAILKKD
FLAQDVFFPGTTAIPTRAAPISLTEGVSDASGVLTTAVGGAFSLPPQLSTLIPPSPAPTG
GPGPSPEAEEETTTTLITTTTVTTVHSPVLCNNNISESEGLLEAPEYGGSTFFGGLDCTY
SVSVYLGYGVEIRVERLNLSKEEALSIEGLEEDRRFLLANETLMAEGQVIRSPTNHVAVR
FQTYRATSPGAFRLRYQAFVLSCVFPPRPENGEVTVTDLHPGGAANFRCSAGFTLKGGES
LVCLNISRPEWSGKPPVCAASCGGVIRNATVGRIVSPDISTSHSNNHGNNLSCHWLIEAA
EGQRLHLHFERVSLDEDNDRLVVRSGSSPLSPVIYDSDIDDVPERGLLSDAQSLYIELIS
DNPAVPLLLSLRYEVFSESRCYEPFLAHGNFTTTDPLYSPGSLVSFFCNAGYMLEQGPPV
IECVDPADPHWNESEPVCKALCGGEISEPAGVILSPDWPQNYGKGQDCVWGIHVQEDRRV
LLEIEILNIRRSDALTVYDGDDLTARVLGQYMGVHQRFNLFSSANDVTLQFQSDSNDPVF
SLSQGFIIHFKEVPRNDTCPALPEVPNGWKTSSHPDLIRGTVVTYQCEPGYDISGSDILT
CQWDLSWSNAPPTCEKILNCADPGEIANGVRRASDPRFPIGSHVQYSCNEGYTLEGSRTL
TCYNRDTGTPKWSDRIPKCVLKYEPCLNPGVPENGYQTLYKHHYQAGEALRFFCYEGFEL
IGEVTITCAPGHPSQWTSQPPLCKVAYEELLDDRKLEVTQTTDPSHQMEGGNIALAIFLP
IILVILLIGGIYIYYTKFQGKSLFGFSFPASHSYSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences Q6AX42
gi|148236193|ref|NP_001087427| gi|50925315|gb|AAH79770| gi|82181890|sp|Q6AX42| NP_001087427.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]