SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51261462|gb|AAH80039| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51261462|gb|AAH80039|
Domain Number 1 Region: 253-371
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.17e-55
Family Calsequestrin 0.00000176
Further Details:      
 
Domain Number 2 Region: 152-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-25
Family Calsequestrin 0.0000541
Further Details:      
 
Domain Number 3 Region: 27-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.62e-17
Family Calsequestrin 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51261462|gb|AAH80039|
Sequence length 417
Comment LOC398424 protein [Xenopus laevis]
Sequence
LCCLTMYWLWLLVLGALGPLVGTEEGLHFPTYDGKDRVLELGEKNYRQLMKKHKVFCILL
QTAPPSGDKIAQRRLHLTDMVLELTAQVLERKQIGFGLLDPKKNSKIAKKLGCSEEGSLY
VFKEDNVIEFDGEMAADVIVDFLLDLIEDPIEVINSKVELKVLDHMEEEMKLIGYFKGED
SEHYKEYEEAAEHFHPYIKFFATFEKTVAKALSLKMNEVDFYEPFMEEPVTIPEKPYSEE
ELVDFIQKHKRATLRKLRPEDMFETWEDDLDGIHIVAFAEEEDPDGYEFLQILKEVAREN
TENPELSIIWIDPDNFPLLVSYWEKTFHIDLFRPQIGVVNVTDADSVWMEMKDAEDLPSP
DELEQWIEDVLSGKVNTEDDDDDDDDDDDDDDDDDDDDDDDDDEDHDDDDDEDDDDY
Download sequence
Identical sequences Q68F08
gi|51261462|gb|AAH80039|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]