SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51593482|gb|AAH78501| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51593482|gb|AAH78501|
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.33e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 78-123
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000066
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51593482|gb|AAH78501|
Sequence length 129
Comment LOC446920 protein [Xenopus laevis]
Sequence
MAEKPVLHYFNGRGRMESIRWLLAAAGVEFVEKYIETREQYEQLLKDGILMFGQVPLVEM
DGMKLTQTKAILSYLAGKYNLYGNDQKERLFIDMYVDGTSDLLSLGLMYIFLDDSVKEKQ
KKKKRKKKK
Download sequence
Identical sequences Q66KZ8
gi|51593482|gb|AAH78501|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]