SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52138911|gb|AAH82636| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52138911|gb|AAH82636|
Domain Number 1 Region: 61-340
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-54
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Domain Number 2 Region: 1004-1235
Classification Level Classification E-value
Superfamily RNI-like 2.16e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 3 Region: 615-691
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000532
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52138911|gb|AAH82636|
Sequence length 1259
Comment MGC80880 protein [Xenopus laevis]
Sequence
MEAKKDSARRLRSIDRTRYAEHEDLSDVEDMVSIRGFSLEQKVSCNAYRGNFVRYMEGKD
FTYEYVQREALQTPLLFSTKEGLGIKMPEQDFTVRDVKLLVGSRRVVDVMDVNTQKSIDM
SMSQFVRYYETPEMEREKLYNVISLEFSHTKLERVVKRPTVVDAVDWVDNMWPRHLKEQQ
KESTNVIAEMKYPKVKKYCLMSVKGCYTDFHIDFGGTSVWYHVFRGGKVFWLIPPTGHNL
QLYEEWLLSGKQTDIFLGDRSEGCQRIELKQGQTFFIPSGWIHAVYTPADSLVFGGNILH
SFNIPMQLRVFEIEDRTRVNAKFRYPFYYEMCWYVLERYVCTLTKRSHLIKEYQRESMIT
DRKPSLDSHSSDSWLEMEEESCDIHIKEEKGNLVEKPSKQSGDESSTTNSTHSNGKDAAE
KKQKATLMQQLKRTLSNDSDESSKSIVHSDFPKTPTGSPATDMPCKLTHLTEFELKGLKA
LVEKLESLPENKKCVPEGIEDPQALLEDMKTVLKEHADDDNNLAISGVPVVMWPKKPSKN
RAVGRPKGKIASSPAVKLSANRTSAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGP
GRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDCVEGQEAKFNVMLMECSICNEIIHPGC
LKTKESDGVVNDELPNCWECPKCNHAGKTGKVYKQKRGPGFKYASNLPGSLLKEQKVNRD
NKELTEIVKKKVEREETPKQIPEEQPKKKPTEGIIKKKPEDGHVRKKRKFEKPPDPSVRK
RLKLVKEEKLLRKKRRSWKTPDERAMMAKTLRRIKQEPDDDLTEAAPKAKESDQSRSSSP
TAGPSTEGSEPKEKKKIRRKRRVSNKELSKELSKELNQEIQKTESSLASENHHPIKSEPE
SDNEESKKCISTNGERMHNFSKGLNGTPKELRHELFPSLKTTPRANNRPPPSLSPPKCMQ
MERHVIRPPPISPPPDSLPLANGAAHVMQREVWMAIFSYLSHRDLCICMRICRTWNRWCC
DKRLWTQIDLNRCKSITPLMLSGIIRRQPASLDLSWTNISKKQLSWLINRLPALRDLNLS
GCSWIAVSALCSSCCPLLRTLNVQWVEGLKDAQMRDLLSPPTDNRPGQIDNRSKLRNITE
LRLAGLDITDASLRLMIRHMPLLAKLDLSYCNHVTDQSINLLTAVGTSTRDTLLEMNLSD
CNNVTDQCLTFFKRCGNICLIDLRFCKQVSKESCEQFIAEMSVIVQFGQTEEKLLQKVS
Download sequence
Identical sequences Q640I9
gi|148233062|ref|NP_001085840| gi|52138911|gb|AAH82636| gi|82180866|sp|Q640I9|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]