SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54311211|gb|AAH84782| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54311211|gb|AAH84782|
Domain Number 1 Region: 36-503
Classification Level Classification E-value
Superfamily Sema domain 8.5e-134
Family Sema domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 1343-1472,1667-1856
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1035-1139
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000129
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.032
Further Details:      
 
Domain Number 4 Region: 851-949
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000312
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 948-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000000178
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 6 Region: 506-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000275
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1155-1227
Classification Level Classification E-value
Superfamily E set domains 0.00000109
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 805-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54311211|gb|AAH84782|
Sequence length 1886
Comment LOC495321 protein [Xenopus laevis]
Sequence
MLLHAGKPLLFHLWTFLVLLGSWITTGDGTPKGFRTFTGSDWSLTHLVVHNKTGEVYLGA
INRIYKLSNNLTLLRTHVTGPVEDNEKCYPPPSVQSCPHGLFTTNNVNKLLLVDYADNRL
IACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVPNGQNKLFVGT
PIDGKSEYFPTLSSRKLLANEENAEMFSFVYQDEFVSSQLKIPSDTLSKFPTFDIYYVYS
FSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCMKDGVEY
RLIQDAYLSKPGKRLAKELGISEREDILFTVFSQGQKNRIKPPKESVLCLFTLKKIKDKI
KERIQSCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTPLFLD
KEDGMTSVAAYDYRGHTVVFAGTRSGRMKKILVDLSASSSYMAQQYENVVVHEGNAILRD
LVLSPDRQYIYAMTEKQVTRVPVESCEQYESCDACLGSRDPHCGWCVLHNTCSRKDKCER
ADEFHRFSSDQHQCVQLTVHPKNISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGR
ILDGNIYCTSPSAKEVIPITRGHGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLS
CVNGSFPCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPSSQIYIPVGVVKPITLTA
KNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDVSDLPVNLSVV
WNGHFVIDNPQNIQAHLYKCSALRESCGLCLKADRSFECGWCVSEKKCTLRQNCPILENP
WMHASTTNSRCTDPKITKLFPETGPRQGGTRLTITGENLGLRFEDIHIGVKVGQVVCVPI
ESEYISAEQIVCEINDAGRTRVHEAQVEVCVKDCSQDYRAISPKSFTFVVPSFNRVTPSR
GPLSGGTWISIEGNYLNAGSDVSVYIGGRSCMFSWRTAKEIRCKTPQGPSTGKAEIQIHI
NRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGMNLATIKEPHIRAKYGDVEK
ENNCTVYNDTTMVCLAPSVDNPLRNPPENGDRPDEIGFIMDNVHALLIVNTTNFLYYPDP
VFEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIGDTPCALTVSETQLLCES
PNLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRK
SRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRIYAMR
VLFPGIEDHPVLKEMEVQANVEQSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVA
SLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLY
KFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTMNCVNP
ENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKTGDMDLEWRQGRIARIILQD
EDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTA
SSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFW
VNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYK
SWVERYYADIAKMPVISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYRDEILTAL
EKDEQARRQRLRSKLEQVIDTMAQSS
Download sequence
Identical sequences Q5U5A2
NP_001088457.1.7800 gi|147905474|ref|NP_001088457| gi|54311211|gb|AAH84782|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]