SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56541147|gb|AAH87486| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56541147|gb|AAH87486|
Domain Number 1 Region: 225-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.2e-31
Family Thioltransferase 0.0000184
Further Details:      
 
Domain Number 2 Region: 124-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-28
Family Thioltransferase 0.00011
Further Details:      
 
Domain Number 3 Region: 7-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-27
Family Thioltransferase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56541147|gb|AAH87486|
Sequence length 326
Comment LOC496161 protein [Xenopus laevis]
Sequence
MAAVLEAGSQSQFEELLQKSAKSLTVVHFWAPWAPQCTQMNEVMAELAKEQPQVMFVKLE
AEAVPEVSEKYEITSVPTFLFFKNSQKIDRLDGAHAPELTKRVQRHASSTSFPATPNSAP
KEDLNGRLKKLINAAPCMLFIKGSPQEPRCGFSRQIVDILNQHKIQFSSFDILSDEEVRQ
GLKTFSDWPTYPQFYVNGELLGGLDIVKEMVASGELDQMCPKAQNLEERLKVLVNKAPVM
LFMKGNKEMAKCGFSRQILEIMNNTGVNFETFDILEDEEVRQGLKAYSNWPTYPQLYVKG
ELVGGLDIVKELKENGEFVSVLKGDQ
Download sequence
Identical sequences Q5M993
gi|147898819|ref|NP_001088850| gi|56541147|gb|AAH87486| NP_001088850.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]