SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|64830|gb|CAA45353| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|64830|gb|CAA45353|
Domain Number 1 Region: 176-241
Classification Level Classification E-value
Superfamily Homeodomain-like 1.67e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.81e-16
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000376
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|64830|gb|CAA45353|
Domain Number - Region: 91-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0197
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|64830|gb|CAA45353|
Sequence length 403
Comment homeobox protein [Xenopus laevis]
Sequence
MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLN
NNNAAKENSFISVTGSDPSLSPESQDPLQDDAKDSESANVSDKEAGINENDDQNLGAKRR
GPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQL
SALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFAFYGDYQSEYYGPGSNYDFFPQGPP
SSQAQTPVDLPFVPSSVPAGTPLGAMDHPIPGHHPSSDAQRFTDIMSHPPGDSPSPEPNL
PGSMHSMSAEVFGQSPPFSSLSVNGGYGNHLSHPPEMNETAVW
Download sequence
Identical sequences B7ZP59 P29674
NP_001084128.1.7800 gi|148225925|ref|NP_001084128| gi|213623130|gb|AAI69338| gi|213623134|gb|AAI69340| gi|267419|sp|P29674| gi|64830|gb|CAA45353|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]