SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76779469|gb|AAI06272| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76779469|gb|AAI06272|
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-80
Family BAR domain 0.0000000186
Further Details:      
 
Domain Number 2 Region: 286-362
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76779469|gb|AAI06272|
Sequence length 366
Comment MGC78966 protein [Xenopus laevis]
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDLTTKAVADVLAKTIEYLQP
NPASRAKLSMLNTVSKIRGQVKNPGYPQPEGVLGETMVKYGKDLGDESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQGKIPD
EELRQAMEKFIESKEVAETSMINLIDTDVEQVSQLSALVEAQLEYHRQAVQILDELSDKL
KNRMRESSSRPRREFKPKPRESYEYTESEQSNGGFCNPANKVQASSSFRSEKPARTNNRS
SAPLDQPCCKSLYDFEPENDGELGFREGDIITLTNQIDENWYEGMINGQSGFFPVNYVEI
LVPLPQ
Download sequence
Identical sequences Q3KQD0
gi|76779469|gb|AAI06272|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]