SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82181879|sp|Q6AX23| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82181879|sp|Q6AX23|
Domain Number 1 Region: 401-511
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 2.22e-29
Family FAD-dependent thiol oxidase 0.0033
Further Details:      
 
Domain Number 2 Region: 36-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-22
Family PDI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82181879|sp|Q6AX23|
Sequence length 661
Comment RecName: Full=Sulfhydryl oxidase 2; AltName: Full=Quiescin Q6-like protein 1; Flags: Precursor
Sequence
MAAFVGLPLRSVPMLLLLLLLVVAGTARGETLYGPEDSVTILNKESVARAVFNSSSAWLL
EFYSSWCGHCINYAPTWKALARDVRDWEPAIKIGVLDCAEEDNYGACKDFGVTLYPTFRF
FKAFTKEFTQGENYKAVGDREIQTVRQVIIDFLQTSPAESKPQAWPSLEPISSSEISSLL
TPKQSHYTAIIFESEESYEGREVILDLIQYSNIVVRRALPSDKPILEKLGIGSVPSCYLI
QPNGLHGLINDVKSIRSQLSLHLKALSNVRKLLPSETAHSGLSKGVQQEDTTMNQFDRSK
LYMTDLESGLHYILRAELANHHTLEGEKLKTFKDFVTILYKLFPGRPHVMKLLETLQEWL
VSMPLDTIPYDAILDLVNNKMRISGIFLTNHTQWVGCRGSKSNLRGYPCSLWKLFHSLTV
QAAVKPDALANTAFEAEPRAVLQTMRRYIREFFGCRECAKHFEAMAKETVDSVKTPDQAI
LWLWRKHNVVNNRLSGAPSEDPKFPKVQWPTSDLCSACHSQTGGVHSWNEDEVLAFLKRY
YGNQEISLEFADPRKDLSEAATDNGNKEPHFTKKPQERDYVKKQNPQFLDKLVQKKPEKS
LDSEAAESSQSVSFLGIGFSNIDMSLCVILYVTSSLFLMIMFFFFRFRSKRWKVRYNRPF
V
Download sequence
Identical sequences Q6AX23
NP_001087446.1.7800 gi|148226676|ref|NP_001087446| gi|50927234|gb|AAH79798| gi|82181879|sp|Q6AX23|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]