SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|961515|gb|BAA07374| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|961515|gb|BAA07374|
Domain Number 1 Region: 35-503
Classification Level Classification E-value
Superfamily Sema domain 4.71e-134
Family Sema domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 1346-1472,1686-1875
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1035-1139
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000303
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 4 Region: 851-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000037
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 948-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000000537
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 6 Region: 506-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000785
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1155-1227
Classification Level Classification E-value
Superfamily E set domains 0.0000011
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 805-838
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|961515|gb|BAA07374|
Sequence length 1905
Comment plexin [Xenopus laevis]
Sequence
MLLHAERPLPFHLWTFLVLLGSWIATGDGSPKDFRTFTGSDWSLTHLVVHNKTGEVYVGA
INRIYKLSNNLTLLRTHVTGPVEDNEKCYPPPSVQSCPHGLITTNNVNKLLLIDYSDNRL
IACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVPNGQNKLFVGT
PIDGKSEYFPTLSSRKLLGNEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYVYS
FSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCMKDGVEY
RLIQDAYLSKPGKRLAKELGISEREDILFTVFSQGQKNRIKPPKESVLCLFTLKKIKDKI
KERIQSCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTPLFLD
KEDGMTSVAAYDYRGHTVVFAGTRSGRVKKILVDLSASSSHLVQQYENVVVHEGNAILRD
LVLSPDRQYIYAMTEKQVTRVPVESCEQYESCDTCLGSRDPHCGWCVLHNMCSRKDKCER
ADELHRFTSDQRQCVQLTVHPKNISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGR
ILDGKIYCTSPSAKEVIPITRGHGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLS
CVNGSFPCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPSSQIYIPVGVVKPITLTA
KNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDISDLPVNLSVV
WNGHFVIDNPQNIQAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPTLENP
WMHASTANSRCTDPKITKLFPETGPRQGGTRLTITGENLGLRFEDIRFGVRVGHVMCVPV
ESEYISAEQIVCEINDAGRTRVHEAQVEVCVKDCSQDYRAISPKSFTFVLPSFNRVTPSR
GPLSGGTWISIEGNYLNAGSDVSVAIGGRPCMFSWRTAKEIRCKTPQGPSTGKAEIQILI
NRATMNNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGMNLATIKEPKIRAKYGDVEK
ENNCTLYNDTTMVCLAPSVDNPLRSPPENGDRPDEIGFIMDNVHALLIVNTTSFLYYPDP
VFEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIGDTPCALTVSETQLLCES
PNLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRK
SRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLEYRTYAMR
VLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVA
SLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLY
KFLKECAGEPLFMLHCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLNPCADDV
GLSDESCCRSPQTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKA
GDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNIS
NSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRG
SKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQI
TDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKL
GKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPVISDQDMSAYLAEQSRLHLSQFNSMSA
LHEIYSYITKYRDEILTALEKDEQARRQRLRSKLEQVIDTMAQSS
Download sequence
Identical sequences Q91823
NP_001081382.1.7800 XP_018112005.1.7800 XP_018112006.1.7800 gi|148230731|ref|NP_001081382| gi|961515|gb|BAA07374|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]