SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000062 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000062
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-80
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 233-355
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-34
Family Spectrin repeat 0.000000643
Further Details:      
 
Domain Number 3 Region: 469-587
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-29
Family Spectrin repeat 0.00000625
Further Details:      
 
Domain Number 4 Region: 356-464
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-25
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 5 Region: 593-705
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-22
Family Spectrin repeat 0.00000336
Further Details:      
 
Domain Number 6 Region: 704-825
Classification Level Classification E-value
Superfamily EF-hand 1.1e-21
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000062   Gene: ENSXETG00000000040   Transcript: ENSXETT00000000062
Sequence length 858
Comment pep:known scaffold:JGI_4.2:GL173097.1:938398:959187:-1 gene:ENSXETG00000000040 transcript:ENSXETT00000000062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVN
KALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWC
QRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAER
YLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEH
LMEDYEKLASDLLEWIRRTIPWLENRVPEKTMHDMQQKLEDFRDYRRVHKPPKVQEKCQL
EINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNAIRRLERLDH
LAEKFRQKALIHEAWTEGKEAMLKQKDYESATLADIKALIRKHEAFESDLAAHQDRVEQI
AAIAQELNELDYYDSPSVNARCQKICDQWDLLGSLTHTRREALEVTEKQLEAIDQLYLEY
AKRAAPFNNWMEGAMEDLQDMFIVHTIEEIEGLIAAHEQFKSTLPDADREREAILGIQNE
AQKIADYSHIKLASGNPYTTVTPQIINSKWEKVQQLVPKRDGALKGEHDKQQSNEHLRLQ
FASLANVVGPWIQAKMEEIGRIAIELHGTLEDQMTHLKQYEQSVINYKPNIDKLEQQHQL
IQEALIFDNKHTNYTMEHIRVGWEHLLTTIARTSNEVENQILTRDAKGISQEQMHEYRAS
FNHFDRDHTGALGPEEFKACLISLGYDVENDRQGDAEFNRIMAIVDPNNTGMVTFQAFID
FMSRETTDTDTADQVIASFKVLAGDKNYITAAELRRELPPDQAEYCIARMAPYQGPDAVP
GALDYMSFSTALYGESDL
Download sequence
Identical sequences F6V4J5
ENSXETP00000000062 ENSXETP00000000062 8364.ENSXETP00000000062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]