SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000063 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000063
Domain Number 1 Region: 29-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-88
Family Calponin-homology domain, CH-domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 278-400
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-32
Family Spectrin repeat 0.000000535
Further Details:      
 
Domain Number 3 Region: 514-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-32
Family Spectrin repeat 0.00000281
Further Details:      
 
Domain Number 4 Region: 401-509
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-25
Family Spectrin repeat 0.00000211
Further Details:      
 
Domain Number 5 Region: 743-870
Classification Level Classification E-value
Superfamily EF-hand 1.29e-23
Family EF-hand modules in multidomain proteins 0.038
Further Details:      
 
Domain Number 6 Region: 639-750
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-22
Family Spectrin repeat 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000063   Gene: ENSXETG00000011409   Transcript: ENSXETT00000000063
Sequence length 898
Comment pep:known scaffold:JGI_4.2:GL173264.1:28282:68503:-1 gene:ENSXETG00000011409 transcript:ENSXETT00000000063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKMTTIETHIQYSNSYNMTEEDYMVQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAG
TQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFIASKGVKLVS
IGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNF
HISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVN
TPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEW
IRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSN
RPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESW
TRGKEELLTQRDYESASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDA
ASVNSRCQAICDQWDNLGTLTQKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAV
EDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGI
NPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSK
MEEIGRISVDISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYS
MEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPD
DFRACLISMGYDLGEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFK
ILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL
Download sequence
Identical sequences F6V4H1
ENSXETP00000000063 ENSXETP00000000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]