SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000090 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000090
Domain Number 1 Region: 739-1027
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-75
Family Protein kinases, catalytic subunit 0.000000267
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-21
Family MAM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000090   Gene: ENSXETG00000000055   Transcript: ENSXETT00000000090
Sequence length 1160
Comment pep:novel scaffold:JGI_4.2:GL172704.1:148077:178722:-1 gene:ENSXETG00000000055 transcript:ENSXETT00000000090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNWKMLSAEIAGVNEPFQISLDYIHCVQTADHPIVLESLTLRHCSADICYQDSVMPTCVG
ENSFFCDNGDCINYVNLCDFSNDCPTGEDEGALCEIILPSGSYCSFDDGTCGWTPYDGND
TTWLYTDATQIEDTSPSDLKLVKVTGHFLYLSVQSKRSDGSATIYSAVFPKVVTNNVCQL
SFKFLISGIYNGSLGIYGLEDGKGMGSSVKLWVKQGASGNFWNPGTLQIPQFQNRFRLLV
VATWGWNSLAHIALDNVTFSVDCFHAGLRPFLVQSGISILDLDPNPEPQPSGSQYLPCCN
WFTSCGASGPHGPTQTQCDNAYRSSNISVVVGKEGPLRGVQLWKVPFTSVYQISAYGAAG
GKGAKNHNNPAHGVFISAIFPLQKDEILYILVGQQGEDACPGKNELTKEICMGKSSIIED
NYDDQNRFSEWAGGGGGGGGASYVFKEVNGEFIPLLVAAGGGGKAYLEDQEDPLDFIHPE
RFENNTAVPGPNGMSGAAGGGGGWNDITELPVAGKSLLFGAEGGQTCYKAITKLQWHTSG
GFGGGGGPCTSGGGGGGYQGGNASELDDIFTDGQYGVSFFHPSVKIFLHPLAAMESHGEV
QIKLFVNCSHCYTDNCKRDPINRSVVCLCEVGTVLASDNTTCVGILMKNCFFTLYSLTHC
YFVLLLVPKWPLAEKQLPLSLILAVLIATVILGIIFACGSLSFVYHRKKKQLEGARVRLQ
STEYKLSKIRSSIIMTDYNPNYCFAGKGASLSELKEVPRKNITLLRALGHGAFGEVYEGM
VVGISGDPNPLQVAIKTLPEICSEQDEMDFLMEALIISKFSHQNIVRCIGVSLQTLPRFI
LLELMSGGDMKSFLRQNRPWINQPSTLSMLDLLNMARDIACGCKYLEENHFIHRDIAARN
CLLTYSGTGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGVFTSKTDTWS
FGVLLWEIFSLGYMPYPCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHTPEHRP
NFSTILERISYCTQDPDVINTPLPVESGPAPEDEGSTSIRPNSCNGLNPIMSSQPIAPLL
DTQSTEQKLGDVPQELLVENLAGWNIKTPGLQTVAESTEGSWFQSNLSTTTEPKLQTTHK
LKNKSKNLWNPTYGSWVMES
Download sequence
Identical sequences F6UBP5
ENSXETP00000000090 ENSXETP00000000090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]