SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000106 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000106
Domain Number 1 Region: 172-222
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000379
Family Hepsin, N-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 3 Region: 143-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000106   Gene: ENSXETG00000027064   Transcript: ENSXETT00000000106
Sequence length 226
Comment pep:novel scaffold:JGI_4.2:GL173384.1:123177:134418:-1 gene:ENSXETG00000027064 transcript:ENSXETT00000000106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNVYVIPPSNNDYELPPPPPYEPPPYTTVPKPSPPPYTAQVQSGQFVARPPITPSTGT
RRRRICIISFIVICKVAAIVAGLIIGFVVTKRPSTTPSTPTCQMYCSYTYTCIHAYQICD
GVQDCRYGDDERNCGATLPANCEKRCGSSVSCVRSSQWCDGVSQCPNGEDETSCVRLYGA
DSQLQVYSTLKSAWLPVCADNWSDAYGRFACRDFGYSGYATVDIIS
Download sequence
Identical sequences F7C235
ENSXETP00000000106 ENSXETP00000000106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]