SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000109 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000109
Domain Number 1 Region: 221-468
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.42e-80
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 129-229
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-16
Family Hepsin, N-terminal domain 0.076
Further Details:      
 
Domain Number 3 Region: 95-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000109   Gene: ENSXETG00000000063   Transcript: ENSXETT00000000109
Sequence length 473
Comment pep:novel scaffold:JGI_4.2:GL173799.1:119101:137187:-1 gene:ENSXETG00000000063 transcript:ENSXETT00000000109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAMHCEPPPYCEHEDAPHHHNVPHYPEPIPHNVYEASPESSPQYVPEVPSRSVAAHKNGA
LCNARSRKISRISAALCVLIAAIIIIAVLSWHFGTATKCQASCGSSSNCVLVSQWCDGVK
HCPNGEDESSCLRMYGPNFQLQAYSASKATWLPVCADNWGDSIGRTACQDIGYSSSSYIK
SNAVTAPASDGYVRLNNYAGTGNIFASLNYSSTCSSGLVVSLKCIDCGLSTYGESRIVGG
SSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCVQGDTSSPSLWKAFIGKIKMPS
YYDSSAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVCLPNYGMQWEEGQPC
YISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAITSSMICAGYPKGGVDSCQG
DSGGPLVTKTNSLWWLVGDTSWGDGCANVYRPGVYGNMTVFLQWIYLQMQVTE
Download sequence
Identical sequences F7C223
ENSXETP00000000109 ENSXETP00000000109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]