SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000001849 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000001849
Domain Number - Region: 160-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0119
Family LDL receptor-like module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000001849   Gene: ENSXETG00000000831   Transcript: ENSXETT00000001849
Sequence length 228
Comment pep:known scaffold:JGI_4.2:GL173203.1:42530:56177:1 gene:ENSXETG00000000831 transcript:ENSXETT00000001849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSLLDLRDIEVKMGRKVPESLAKSLREEHYWDWSKDGRDGYAEYPEVPGSFPQSSSL
ERLESSLTDSKNTSFICGVCRRVLFSALEKTCVSFHVYRLDMVYLRATDVKLMRQLLIIN
ESIESIKWMMEEKDIVTSQGSSLSGSLCSLLESNDASLRGSCNSLQDCSDGMDEMSVGSY
LDTLADIVPRHCTPSDFDQYSDTQENALNHQPISNNSSNQSDEYYCFR
Download sequence
Identical sequences F6TU10
ENSXETP00000001849 ENSXETP00000001849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]