SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000002556 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000002556
Domain Number 1 Region: 144-268
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-45
Family Nucleotide and nucleoside kinases 0.000000805
Further Details:      
 
Domain Number 2 Region: 18-99,137-171
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-29
Family SH3-domain 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000002556   Gene: ENSXETG00000001179   Transcript: ENSXETT00000002556
Sequence length 270
Comment pep:known scaffold:JGI_4.2:GL173764.1:14359:21655:1 gene:ENSXETG00000001179 transcript:ENSXETT00000002556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMNSSLGSGSASLHNANGAKRGFYIRALFDYDKTRDCGFLSQALSFKFGDILHVIDATDE
EWWQARRVLPEGEEIGFIPSKRRVERREWSRLKDVLGNWVPCRRFVLNTLPFGLGSIRFA
LNTLPGREETVLSYEVVVHMEVHYARPIIILGPGKDRVNDDLLSEFPDKFGSCVPHTTRP
KRDYEVDGRDYHFVSSREKMEKDIQSHKFIEAGQYNGHLYGTSVQSVREVAEQGKHCILD
VSANAVRRLQAAQLQPIAIFIRPKSLENIL
Download sequence
Identical sequences F6USZ4
ENSXETP00000002556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]