SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000002647 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000002647
Domain Number 1 Region: 189-251
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.09e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000682
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000002647   Gene: ENSXETG00000001225   Transcript: ENSXETT00000002647
Sequence length 269
Comment pep:known scaffold:JGI_4.2:GL176538.1:3719:9425:-1 gene:ENSXETG00000001225 transcript:ENSXETT00000002647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLQLNYTKIEQLCTGEWPSGSWGPPAGTPLSSIT
PPPEIWASGFLPRALGTTPAPPPFAPPHALVQGLPWCHGDGMLRGRGCHGATEIACLGAG
VAMVPHYSRWVFMSSALQFLPSAPLTVPQRTSPTGPKTMQAPVRLQNTAPPLRKNPPITR
NGGHDMDSQVVELNQQLVELKLTVDGLEKERDFYFSKLRDIELICQEHESENVGVLSKII
DILYATEEGFAPPDDDENDDPQPEDQDEY
Download sequence
Identical sequences F7BU39
ENSXETP00000002647 ENSXETP00000002647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]