SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000002790 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000002790
Domain Number 1 Region: 588-847
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-21
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 2 Region: 307-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 3 Region: 32-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 188-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 5 Region: 350-394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 228-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 7 Region: 115-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 267-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 74-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 436-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 1-29
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 965-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000686
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1069-1110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.03
Further Details:      
 
Domain Number 14 Region: 395-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 15 Region: 929-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000783
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 444-559,839-884
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000879
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 17 Region: 889-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000681
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000002790   Gene: ENSXETG00000001300   Transcript: ENSXETT00000002790
Sequence length 1281
Comment pep:novel scaffold:JGI_4.2:GL173802.1:790:106891:1 gene:ENSXETG00000001300 transcript:ENSXETT00000002790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFRCNTDKCIPFWWKCDTVDDCGDGSDEPAECPEFKCQPGRFQCGSGLCALPAFICDGEN
DCGDNSDELNCDTYVCLSGQFKCTKKQKCIPINLRCNGQNDCGDEEDEIDCPENSCSPDH
FQCKTTKHCISKLWVCDEDSDCADGSDEANCVKKKSKKKNCTLNFLRTRQQLRCCSLDIL
SKDHCKEPQTCALKEFLCSNGDCISSRFWCDGEYDCADGSDERNCETGCSKEQFQCSTGQ
CISAKWKCDGHEDCKSGEDEKNCEPVSPTCSSSEYVCDSGGCVSAYLRCNGEYDCADGSD
ENDCVAECKENQFRCRNRAYCIPLRWFCDGVQDCVDGSDEDNCERETANICRADEFLCNN
TLCKLQLWLCDGEDDCGDNSDEVPEMCVKFLCPPTRPFRCHNNRVCLRTEQICNGLDECG
DNSDEACCGIKTRQKVKPCKKDEFTCNNKKCISVDLQCDKFDDCGDESDEQGCKMEMGEF
SCEDDVNPCGDDAYCNQTNTPAVCHCKAGFQRNLKNRQCEDINECLLLGSCSHHCTNLKG
SYRCLCDRNFLERNHSCIAQDTEDQVLYVANDTEVLSFTYPFRHNAKHQQISRIAYNSRI
TGMDMYLQGNMIIWSTQFNPGGIFFNTFHGRGGKETKSGLICPEFKRPRDIAVDWIAGNI
YWTDHSRMHWFSYYTSHWTSLRYSINVGQIHGPNCTRLLTHIAGEPYAIAVNPKKGMMYW
TVIGDRSHIEEAAMDGTLRRIIVQKNLQRPTVLEVENFSNMAVWSEMTGSCLLIVLRQNM
SYILSYLHLKGLLYPHRIDIFEDYIYGAGLKNGAFRIQKFGNGVMEYLNLNVEKTKSVLI
SHHYKQPNLPNPCLDIKCDFICLLNPSGASCACSEGKILVNGTCMDHNSADDLCKLTCEN
RGRCIINEKGDPRCHCWPSFSGERCEINHCNNYCLNGGTCTASALGRPTCTCAVGFTGPN
CGRKVCENFCQNGGTCSVSAGNQPYCHCLNEYTGDRCQFPVWRYYRGSCLSWSICKLENS
RSLRFLIARLYHVNKCDLKRCCCCCLPQKLCNKVWICLFCENSCSNGKIASSCQLCDGYC
YNGGTCQLDPETNIPACICSANWSGKQCERPAPKSSKSDNTSSRSIAIIVPLVLLVTLIT
TLVIGLLLCKRRRRAKTIRRQPIINGGMNVEIGNPSYNMYEVDHGHNDGSLLDPNFIIEL
DKSRFIGGGPTAYKIAHKAPPIYLNSDLKGPLNPGPNNYSNPVYAKLFVDGHNCRNSLIS
IEERKELLPKKIDNVIRETVA
Download sequence
Identical sequences F6WBA0
ENSXETP00000002790 ENSXETP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]