SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000003087 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000003087
Domain Number 1 Region: 971-1094,1260-1412
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily Sema domain 6.8e-21
Family Sema domain 0.017
Further Details:      
 
Domain Number 3 Region: 459-550
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000121
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 4 Region: 555-637
Classification Level Classification E-value
Superfamily E set domains 0.0000000000121
Family Other IPT/TIG domains 0.095
Further Details:      
 
Domain Number 5 Region: 116-159
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000003087
Domain Number - Region: 641-680
Classification Level Classification E-value
Superfamily E set domains 0.000103
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 275-321
Classification Level Classification E-value
Superfamily Plexin repeat 0.0196
Family Plexin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000003087   Gene: ENSXETG00000001467   Transcript: ENSXETT00000003087
Sequence length 1484
Comment pep:known scaffold:JGI_4.2:GL172832.1:1652638:1703410:-1 gene:ENSXETG00000001467 transcript:ENSXETT00000003087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQLQEEQLDCGAAHLQHPLAITRPLPAVPIYKEKGLTSVAVANVSGYMVVFLGNVSGHLI
KINLDADMKIINKSMQYLEIASGQPVHHVMEFDPMDPTYLFVMTSHQMTRVKVAECAKYR
SCTECLAAADAYCGWCTLEGRCSLQKECQGSEDSAFWMSPNVGQENMCPAMNSIPNKIDI
SSSTQRIILQITGKLPILYQMNVSCDYGNNIITPAVIDPDQDSGQLLHCSFLPRDQFPSF
PPNQDYVTVSMALSVGGNSIIQHKFIIYDCNRTQNMHPKNACTSCVKSRWPCSWCVSQHR
CVSSASQCDTIAQNSTESCPRITATSLTPTPTGVTKDYTLSLLNTNITEGPKLECDFGTE
QTFPAKWLNSSAVVCSNVLLYTSERTQSFPINLQLSDHKGLYLDNPSMLSVEVYNCASQT
PDCSSCLGRADLGHHCSWSESSMSCRLNSEILSISHPYTCPAPDIRKIDPASGPLLGGTL
VTIQGRNLGSRFSDINGRVKIGEIECTPIQEKYIVSEEIVCMTGESPKLLTDWVSVDVNG
GGRSKEKYSFQVPEVDYLSPDFGPWAGGTRVTISGTNLNIGRDVRVLFNKTQECRDLVRT
QSTIQCTVPPMKFLPETKVHICVQFEKKSCVKEELFFKYQENPVIKSMDPRSSPLSGGRI
ITVTGERFDMVQSIMMGIQHDAIMPHPKLLGHTLFSCIEIVKTIVEVFINGVQVDLGKAI
VEAHFSLEYQPDPMFYTAKKEKLIKHHVGEPLTLVIHKEPDNLGLRVDEYRVKVGQIPCE
SIFIFNDKVIHCSINESLSSSQRYLPVTIQVGKFNQTITTLHLAGIDTSIIISIVICSIL
LLLSVVALFVFCTKSRRAERYWQKTLVQMEEMESQIREEIRKGFAELQTDMTDLTKELNR
SQGIPFLEYKHFVTRTFFPKCSSLYEERYILPTQNFNTQLGFQVPETHPLLCGEWKVPEN
CRTNMEEGITLLSTLLNNRHFLVTFIHAVELQKDFAVRDRCNLASHLTIALHGKLEYYTS
IMKDLLVDLIDSSASKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAI
KQQINKGSIDAITGKARYTLNEEWLLRENIEAKPMNLNVSFQGCGMDSLCVRVLDTDTVS
QCKEKILEAFCKNLPYSQWPRVEDVDLEWFASSSKSYILRDLDDSSIMEDGKKKLNTLAH
YKVHDGASLAMSLKDKRDDTLGRVKDLDTDKYFHLVLPTDDLAETKRSHRQSHRKKVLPE
IYLTRLLSTKGTLQKFLDDLFRAILSIHEDRPPLAIKYFFDFLEEQAEKRGISDPDTLHI
WKTNSLPLRFWVNILKNPEFVFDMDKSDHMDACLSVIAQAFIDACSISDMQLGKDSPTNK
LLYAKEIPEYRKIVQRYYQKIKEMSPLSEQEMNAHLAEESRKYRNKFNTNVAMAEIYKYA
KKYRTQIVTALETNPTTKRGQLQHKFDQVIVLMEDDIYSCSSEA
Download sequence
Identical sequences F7BN01
8364.ENSXETP00000003087 ENSXETP00000003087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]