SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000003741 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000003741
Domain Number 1 Region: 216-468
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.29e-88
Family Eukaryotic proteases 0.0000363
Further Details:      
 
Domain Number 2 Region: 834-1083
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-86
Family Eukaryotic proteases 0.0000546
Further Details:      
 
Domain Number 3 Region: 515-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.85e-84
Family Eukaryotic proteases 0.000074
Further Details:      
 
Domain Number 4 Region: 50-131
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000837
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 185-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000003741   Gene: ENSXETG00000001793   Transcript: ENSXETT00000003741
Sequence length 1085
Comment pep:known scaffold:JGI_4.2:GL173191.1:645616:678079:1 gene:ENSXETG00000001793 transcript:ENSXETT00000003741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKNADIEPVLDVQKASFLGTPCCRWTVAFLLLGSLTISITAALLIMYLTTHSLIVVHT
LEVQGLQYDASLQNRTSLYHRYLTNTLQRLLRSSFRNTVAEEIYIGCTILQYSQGNESII
ASIKLQFRASSHFPGNEEIEELLRQGLASFLRGNTIPVPTFGNISAVLTGRQQGPVSSLG
LKSGSCPAQVFACKNTQCIVKQNPECDNIRDCKDGSDEKNCNCGTRPAMQKTNRIVGGSD
ATKGEFPWQVSLRENNEHFCGATVIGDKWLVSAAHCFNDFQDPAVWVAYIATTSLSGTDS
STVKATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPVCLPDPTHVFPVGKKCII
TGWGYLKEDNLVKPEVLQKATVAIMDQSLCNSLYSNVVTERMLCAGYLEGKIDSCQGDSG
GPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWILDIISSSVAADPQTSFT
TTTTTTTGGRKTTNAKTTTARPFTKHSTTRAKPAECGSRPGLTKPNKIVGGLDAVRGEIP
WQASLKEGSRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAHMGSTALSGADTIAIKISLK
RVIQHPHFNPLTLDFDVAVLELASSLTFNKYVQPVCLPSALQKFPAGWKCMISGWGNIKE
GNVSKPEVLQKASVGIIDQKICSVLYNFSITERMICAGFLDGKVDSCQGDSGGPLACEES
PGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWILDTVAPVPATSNGRRTTTLTRPTMS
QTKSTRSTPRSTTKYTSKRTTTAKTSPTALRITEPARSTQRPGKTSSFLTLFLYIYPFIL
DCGFAPVLPFNKIVGGSGSVRGEWPWQVSLWLRRKEHKCGAVLISDRWLLSAAHCFDIYS
DPKLWAAYLGTPFLNGVEGRVEKIFRIHKHPFYNVYTLDNDVALLELPSPLTYTNLIRPI
CLPDISHIFPEGTRCFITGWGSTKEGGAMSRQLQKASVSIVGDQTCKKFYPIQISPRMLC
AGFMQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITSVRNWIG
QNLRL
Download sequence
Identical sequences F6WP27
ENSXETP00000003741 ENSXETP00000003741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]