SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004396 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004396
Domain Number 1 Region: 543-797
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-86
Family Eukaryotic proteases 0.000000461
Further Details:      
 
Domain Number 2 Region: 122-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-33
Family MAM domain 0.0057
Further Details:      
 
Domain Number 3 Region: 311-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 9-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 456-548
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000017
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 
Domain Number 6 Region: 421-459
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004396   Gene: ENSXETG00000012422   Transcript: ENSXETT00000004396
Sequence length 798
Comment pep:known scaffold:JGI_4.2:GL172680.1:3404342:3537561:1 gene:ENSXETG00000012422 transcript:ENSXETT00000004396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPCDGQFFLSEASGTFHSKNYPQLYDPNLSCRWIISVRDGYSIKFDFQSFDTEEFSDVLD
IYEGIGPNKILRASLWGTNPGTVQIFSNQATAEFITDYSNNHNGFKAIYGTFLSDNVTNE
EKINCNFEDGFCYWFQEIQDYDGWERVHGPTYPPTSGPNEDHTFGNSSGYYLTPGIQVIP
GILKSVRLLSLPLKENSVPLCLSFWYHMYGVNVYRLNVFNIFANSTETIIFQKEGNYGPS
WNYGQVTLSETSGTVVAFEAIQNQRFGDIAIDDIGLFPGSCNESGFPEPTRVPTVPTTAL
LPSDCGGPTELWEPNVTFHSANYPQNYPNLASCVWYLNAAPGKNIQLHFQVFNLENIYDV
VEIRDGRGPDSLLLAVYTGSAPVKDVFSTTSAMSVYFTSDSTGTAKGFLANYTTGLRLGM
PEPCNSTSFQCGSGECIPNTAVCDKHRDCDDGTDERHCVRLFNSSMSGLVQFKVQSEWHT
ACIDHWNEDISNDICHRLGLGNVNLTSAVLSEGNGPFVTLIQVEDGSLSLLPSDQCANQS
VIHIQCQQRECGKRLVPIKSGSKIVGGSDAALGAWPWIVSLYYNDRQTCGASLVNQEWLV
SAAHCVYGRNLIPSNWKARLGLHTNLNLTQPQIATQMIDQIVINPQYNRRTKDSDIVMMH
LQFKVNYSDYIQPICLPETDQEFSVGINCSIAGWGRTQSGGPVPNILQEAEIPLISNHKC
QQQMPEYNITDNMVCGGYEEGGIDTCQGDSGGPMMCQQNNEWFLVGVTSFGYGCAQPSRP
GVYVRVTEFTNWIKSFII
Download sequence
Identical sequences F6QQY8
ENSXETP00000004396 ENSXETP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]