SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000005353 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000005353
Domain Number 1 Region: 659-949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-67
Family Protein kinases, catalytic subunit 0.000000572
Further Details:      
 
Domain Number 2 Region: 50-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000285
Family MAM domain 0.019
Further Details:      
 
Domain Number 3 Region: 10-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000654
Family LDL receptor-like module 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000005353
Domain Number - Region: 557-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000005353   Gene: ENSXETG00000031142   Transcript: ENSXETT00000005353
Sequence length 1157
Comment pep:known_by_projection scaffold:JGI_4.2:GL173008.1:230598:279798:1 gene:ENSXETG00000031142 transcript:ENSXETT00000005353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNLSGLKMALDGVFNCRNGMAIKLRQVCNFIPDCEEEEDEGDLCRNLPPGFYCMFEEGSC
GWALDHLNSRWQVGSVGKSPEFQSHSGSVLYLNVSNSKSAARDVLSSVLFPAPLKNSSCE
LRMSFLLKGFLLGNISVLLVDNKTGKVRTRPLWSFENGEGLGVWQHIVLYLKDVMERFWL
EIHTSWAQESDSIIAFDNVSLSLGCYLTSNGELPLQTVSYLSSNLLMESSNQRLNDTEGD
EQHTEILLSTGYWHFTTCGATGPYGPSQKLCDDTYKNFSVVYGNGGLKGVQMWRVPETNT
YRISGYGAAGGNGGKTPTLAQGISLIGIFELQKDEILYILVGQKGEDACPRANSVLQMVC
IGENTEIEDELRINGSVSEWAGGGGGGGGATYVFKMESGKPVPLLIAAGGGGRAYRSKAS
VIPPERLESNYTIPGMNGKSGAAGGGGGWNDHTALPWAGKSLMEGAIGGESCPQAVKKWG
WETRGGFGGGGGGCSSGGGGGGYIGGNAAEGNSAEMDGLEGVSFISPRGVVYTPPLKVIE
GHGEVEIKLHLNCSHCEMDECLLDPESKRIVCLCERGTVLAEDGVSCIDEALAPAQETHL
PLSLVLSIVTSALVAALILAFSGIMIVYRKKHQELQAIQMELQSPDYKLSKVRTSTIMTD
YNPNYCFAGKVTSIGDLKEVPRKNISLIRGLGHGAFGEVYEGQVLGTPSDPNPLKVAVKT
LPEVCSEQDELDFLMEALIISKFSHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRQT
RPRLNQPSSITMLDLLNVSCDIAHGCKYLEENHFIHRDIAARNCLLTCQGSGRVAKIGDF
GMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYP
SKSNQEVLEFVTSGGRMDPPKNCPGPVYNLIRGLLRKSNSDLLRFSSVVSLEPHKIHISS
LLRTSYGDLRFSSVVSLEPHTVISLLRTSYSDLRFSSVVSLEPHTVMTSYSDFLRTLSVV
SLGTCLTKTYSVAVLKILISFLRSFTGKTVVKTPGPPDKPTPEKENPPSSVTEGNCTAAN
RVAGSRLPGSSLLLEPSTLTSNVQEVPLFRLRHFPCGTVNYGYQQQGLPIEPPMAPPPCP
QKDSAPRSTSSSAQEKL
Download sequence
Identical sequences F6VTG3
ENSXETP00000005353 ENSXETP00000005353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]