SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000005472 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000005472
Domain Number 1 Region: 26-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-90
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 293-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-35
Family Spectrin repeat 0.0000537
Further Details:      
 
Domain Number 3 Region: 2194-2311
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-35
Family Pleckstrin-homology domain (PH domain) 0.00000413
Further Details:      
 
Domain Number 4 Region: 601-740
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-32
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 5 Region: 1009-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-29
Family Spectrin repeat 0.0000243
Further Details:      
 
Domain Number 6 Region: 902-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-28
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 7 Region: 1221-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-27
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 8 Region: 1861-2015
Classification Level Classification E-value
Superfamily Spectrin repeat 5.08e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 1702-1805
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-22
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 10 Region: 527-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 736-853
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-22
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 12 Region: 423-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 1382-1480
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-17
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 14 Region: 1484-1548,1660-1698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000008
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 15 Region: 1999-2081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000314
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000005472   Gene: ENSXETG00000029995   Transcript: ENSXETT00000005472
Sequence length 2363
Comment pep:known scaffold:JGI_4.2:GL172884.1:967574:1063483:-1 gene:ENSXETG00000029995 transcript:ENSXETT00000005472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVATDFDNIEIQQQYSDVNNRWDDEWDNENSSARLFERSRIKALADEREAVQKKTFTK
WVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQF
LKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLW
CQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAE
QHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEK
MIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNL
EVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQ
LARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVV
AVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMD
WMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYK
PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILS
SDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDI
QEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSL
VKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRK
QALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA
SRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHL
ECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKL
EAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQ
TAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQ
RLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLE
AAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRA
GANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAE
LASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKA
ELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQ
AQALSQEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVE
ERMPLATSTDHGHNLQTVQLLMKKNQTHFKMFNKNSLNLLHMNRQSRLVIFAGGAGEEGF
LSLRYPRGSLALFSFKRIFSLLFEYSERLSCPIKQAGCPKTLTHDVAEKFSFLSGQNIYS
SAKNGNPVASLIKYYWFCNKYCTVSCIIMHAKACCSPSVFLPNRPDFSERISMRQSQVDK
LYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQE
RFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRT
QILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGT
QVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFS
MVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLL
ARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEP
YLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKR
KPPTPELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADTNELVNGSTEQR
SSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKAS
SRSWHNVYCVINNQEMGFYKDSKNAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLK
LNDGNEYLFQAKDDEEMNTWIQAITNAITSDKTEVSLSTQSTPASSRAQTLPASVTVTDS
PGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences F7BZ80
ENSXETP00000005472 ENSXETP00000005472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]