SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007281 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007281
Domain Number 1 Region: 189-455
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-48
Family YWTD domain 0.00000684
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-21
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 3 Region: 539-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000119
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 4 Region: 504-538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 5 Region: 460-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000483
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000007281
Domain Number - Region: 145-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000324
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007281   Gene: ENSXETG00000003353   Transcript: ENSXETT00000007281
Sequence length 585
Comment pep:novel scaffold:JGI_4.2:GL172922.1:1111566:1159058:1 gene:ENSXETG00000003353 transcript:ENSXETT00000007281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLFFTDYGTVAKVERCDLDGMNRTRIVVSKIEQPTALTLDLVNKFVYWADVYLDYIEVVD
YEGRNRQSIIQGKEVSHVYGLSLFENYLYASNTDSSTIVRINRFNSTDVHSLLSLENVRD
IHIYHKRTQPAVRSYACEMNPDGMPGGCDHICLLGSSFKMRTCRCKTGFSLASDGRSCKK
PKNELFLIYGKGRPGIIRAMDLNSKVSDEYMLPIENLVNPRALDYHAETNYIYFADTTSF
LIGRQKIDGSGRETILKDDLDNVEGIAVDWISNNLYWTNDGHRKTINVARLEKASQSRKT
LLEGEMSHPRGIVMDPVNGWMYWTDWEEDEIDDSVGRIEKAWMDGSERQIFVTSNMLWPN
GLSLDHENSILYWCDAFYDHIEQIYLNGTLRKVVGSGKELNHPFGLSHHGHSLFWTDYMN
GSIFQLDLRNKNITLLRQERPPLFGLQIYDPKKQQGDNACRLNNGGCGTLCLAIPGGRVC
GCADNQHLDENNSTCVFNVEEKLPQLCNSEEFQCKNYRCIQESWKCDGEDDCLDGSDEDF
ENCLNHSCPNDQFKCRSNRCIPKRWLCDGANDCGSNEDESNETCL
Download sequence
Identical sequences F6ZYU2
ENSXETP00000007281 ENSXETP00000007281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]