SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007320 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007320
Domain Number 1 Region: 25-488
Classification Level Classification E-value
Superfamily Sema domain 6.28e-120
Family Sema domain 0.0000383
Further Details:      
 
Domain Number 2 Region: 1328-1457,1652-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.8e-50
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 836-931
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000675
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 1019-1124
Classification Level Classification E-value
Superfamily E set domains 0.00000000000113
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.069
Further Details:      
 
Domain Number 5 Region: 931-1019
Classification Level Classification E-value
Superfamily E set domains 0.00000000000537
Family Other IPT/TIG domains 0.048
Further Details:      
 
Domain Number 6 Region: 491-540
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000824
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1121-1209
Classification Level Classification E-value
Superfamily E set domains 0.000000028
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000007320
Domain Number - Region: 788-823
Classification Level Classification E-value
Superfamily Plexin repeat 0.000131
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number - Region: 636-676
Classification Level Classification E-value
Superfamily Plexin repeat 0.0562
Family Plexin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007320   Gene: ENSXETG00000003370   Transcript: ENSXETT00000007320
Sequence length 1870
Comment pep:known scaffold:JGI_4.2:GL173779.1:35215:73382:-1 gene:ENSXETG00000003370 transcript:ENSXETT00000007320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLQSLLLLFLTCSVGEGASVFPTFAVSDTSLTHLAVHKHTGDVYLGAVNRIFKLSENL
TELRSHLTGPIADNSSCYPPPSVRVCTHKLSPTDNVNRLLLIDYTGKRVVACGSVWQGIC
QFLRLDDLFKLGEPHHRKEHYLSGAREPDSMAGVIVDQDVEQSKLFIGTSIDGKSEYFPT
LSSRRLVQDEESAEMFRLVYQDEFVSSQIKVPSDTLSLHPSFDIYYVYGFVSKIFVYFLT
LQLDTQQTLLDATGEKFFTSKIVRMCSGDLEFYSYVEFPIGCTKDGVEYRLIQSAYLSRP
GRKLAQALGIPEDEEVLFTVFSQGQKNRSNPPRESVLCLFTLSQINLHIKMRIQSCYHGE
GKLSLPWLLNKELFCISTPIRIHDGFCGLALNQPIGGLQVIEGIPLLEEKVDGMASVAAY
SYNEHSVVFVGTRAGTLKKIRVDSPTDVTLYESVPVVLGKPILRDMVFSPDWQSIYILSE
KQVSKVPVESCQKYNSCSSCLGSGDPHCGWCVLHNRCCRRSECERAGEPNRFTANISQCV
DLEVTPNNASVSVPGQMLTLSVRNVPSLTAGVTCLFGDMAESEATVGDENIHCFSPSAQQ
VPAVIGGSGAIHTIQLYLKSKETGLRFAQTDFVFYNCSVLQSCLSCVNSPYSCHWCKYRH
LCTHNAEQCSFVEGRVNSTEGCPEIIPTGEILIPVGVVQPITLKAKNLPQPQSGQKNYEC
VFNIQGKVQRVPAVRFNSSSVQCQNTSYTYEGNESGDLSVGFSIVWDGHFYIDKPSTFKA
LLYKCPAQRESCGLCLKADPRYECGWCVSEGKCLLRQYCGNSKTNWMHLSKRNMRCSYPR
ISEIQPLTGPREGGTKVTITGSNLGLHYKEVWVQVAGVQCTSVPSEYISAERFVCEMEES
LVPSPAPGVVELCIGDCSAEYRTHSDQLYTFVTPSFHAVSPSRGPSSGGTRLTISGRNLD
AGSSVSVLLRDSECQFVRRTLREIICISPTSSQGPKPANITLRIDKSSILNMDVIYQYTE
DPTISQLEPAWSILNGSTWITVSGAHLSTIQEPQVRAKYSGIETINSCQAVNDTLMLCKA
PGIYSPSGETVLEEGLQPDEFGFLLDNVTSLRTLNSTIFTYYPNPTLESFGPSGTLEIKP
GSHVILKGKNLLPAAPGGAKLNYTVLIGEQPCSLTVSDTQLLCDSPSQTGEHKVTILVGG
MQFSPGSLRIYADSSLTLPAIVGIGAGGGLLLLAIIVVLIAYKRKTRDADRTLKRLQMQM
DNLESRVALECKEAFAELQTDINELTNNMDGVKIPFLEYKTYAMRVLFPGIEDHPVLKES
DVPSNVEKALRLFGQLLNNKTFLLTFIHTLESQRSFSMRDRGNVASLTMVALQGRMEYAT
VLLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLF
CAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKMLTLSCVCPDGENGTEIPVKVLNC
DTITQTKDKLLDAAYKGIPYTQRPKAEDMDLEWRQGRITRIVLQDEDVTTKIECDWKRLN
TLAHYQVTDGSTVALIPKQVSAYNITNSFTFTRSLSRYESLLRTSSSPDSLRSRAPMITP
DQETGTKLWHLVKNHDHSDNKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTA
HRGSALPLAIKYMFDFLDEQAERRQITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
NSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKTWVERYYRDISKMPA
ISDQDMDAYLVEQSRLHANEFNSLSALSELYFYVNKYREEILTALDRDSCRKHKLRQKLE
QVINMVSSNS
Download sequence
Identical sequences F6X457
ENSXETP00000007320 ENSXETP00000007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]