SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007508 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000007508
Domain Number - Region: 38-65
Classification Level Classification E-value
Superfamily Plexin repeat 0.0157
Family Plexin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007508   Gene: ENSXETG00000003470   Transcript: ENSXETT00000007508
Sequence length 184
Comment pep:known scaffold:JGI_4.2:GL172740.1:934180:960078:1 gene:ENSXETG00000003470 transcript:ENSXETT00000007508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGKWAELPGTVALLLMLSLGMAGGSYTSAPVPPVTAACSFYSGRSCEECLKNVSCFWCI
TNNTCLDYPVRNILPPSSLCAMSAARWGACWINFEALIITISVVLGLILLSTTVCCCYCC
YCRKRSNSLMRLEAEEENLMRERERRKQEALQRKNERTVKHNEIRKKYGLLQDMDHPYSR
YENE
Download sequence
Identical sequences F6ZWX1
ENSXETP00000007508 ENSXETP00000007508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]