SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007628 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007628
Domain Number 1 Region: 564-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 643-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000243
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 140-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 698-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000167
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 5 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000122
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000007628
Domain Number - Region: 517-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007628   Gene: ENSXETG00000003532   Transcript: ENSXETT00000007628
Sequence length 933
Comment pep:known scaffold:JGI_4.2:GL173201.1:563104:590436:-1 gene:ENSXETG00000003532 transcript:ENSXETT00000007628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRPCIIFLLIVSLAGGALSCFCDHYPWTSWSSCSKTCDHGTQSRSRTISYDDYYWKHN
CGGLCTMRETRSCNEQSCPINCKLGDFGSWSDCDPCLKKQFRTRSLERPSQFGGEGCTEA
LVESRICVPAKLCKIEQLDCSGKFQCVSGRCIPFNLKCNGDNDCGDNSDERVCRKREPQR
SFEPIPGIQLMGNGFNYLSGESRGEVLDNSFFGGKMDKVYGNGTGQNRKLYRLSANLDTF
KFELRNEEDDAVPTFYNSLIDFDKENSRTGSSQSSRRGSAGIPLLFHRKSNTRITSSSSF
REAAQASRKQSSKFIRINKVISVSDFTMKKNNLWLSDVFLKALNNLPLEYNYPLYSRIFD
DFGTHYITAGSXXXXXXXXXXXXXXXXXPDCSGPRSLECVRTEITYRVFFRKKRKVRESC
TRNKMSERYEGSFVQASEKSISLIKGGRAEYAAKLAWQRQETLPENTVFEEWVKSTIDNP
VVVDFELAPILDLITGIPCAVTKKRNLQKAFAKYLETFDPCICAPCPNNARVVLSGTECL
CICQPGTYGDNCEKRTPDYTSVVVDGAWGCWKAWSSCDGAFTRRRTRECNNPYPRNGGKP
CEGEATQEEACNISLFEDTGALCINEGDKKESDRVQPEHDTGCPKPDLLGIAFLTNEKNW
YNVAEQIEIACVSGYELSGYPFLRCLPDGTWKQEDVECVKTTCPRPKASEDITIYHYKTD
YKVGESIHVSCPRDFVVVGSARYTCGRDLEWNPPILRQLTCGKETQKVIQGNCKPGQKQM
GSDCICMSPETDCGHFTEDLCILDAVTQNPVTISRCKFLAENCLGHKKLQFLDNGPCKRD
QLDWYRTRVSLAVSSTKKEPCGYDFCYDWEQCSGSECFCLLPPQCPPNSEVQYCAKVGSA
GKQRTISLCSLGAIKCASIKVEVLYDGACSTTN
Download sequence
Identical sequences F6VJ44
ENSXETP00000007628 ENSXETP00000007628 8364.ENSXETP00000007628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]