SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007942 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007942
Domain Number 1 Region: 119-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.72e-161
Family Calponin-homology domain, CH-domain 0.00000000244
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily EF-hand 9.64e-18
Family Penta-EF-hand proteins 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007942   Gene: ENSXETG00000003677   Transcript: ENSXETT00000007942
Sequence length 629
Comment pep:known scaffold:JGI_4.2:GL173154.1:725561:779498:-1 gene:ENSXETG00000003677 transcript:ENSXETT00000007942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSTQISKDDLEELREAFARIDTDDSGYISDYELHDLFKEANLPLPGYKVREIIQKLMN
DGDKNKDGKICFEEFVFLVQELKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYS
EEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERV
INKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFAD
IELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQKISNFSSDIKDSRAY
FHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN
PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYND
LQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGKYPAKFSLVGIG
GQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQ
NFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIY
ALPEDLVEVKPKMVMTVFACLMGRGMKKV
Download sequence
Identical sequences Q504Q2
ENSXETP00000007942 gi|63101700|gb|AAH94886| gi|71895717|ref|NP_001025699| gi|89268918|gb|CAJ82954| ENSXETP00000007942 NP_001025699.1.99540 8364.ENSXETP00000007942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]