SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000008136 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000008136
Domain Number 1 Region: 18-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-40
Family Calponin-homology domain, CH-domain 0.000000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000008136   Gene: ENSXETG00000003757   Transcript: ENSXETT00000008136
Sequence length 201
Comment pep:known scaffold:JGI_4.2:GL172675.1:1163231:1169432:-1 gene:ENSXETG00000003757 transcript:ENSXETT00000008136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSRIEKKYDEELEQRLVQWICIQCGDDVGTPEQGRLGFQQWLKNGL
VLSKLINSLYPKGSQPVKIPDPPPSMVFKQMEQVAQFLRASEDYGVVKTDMFQTVDLYEG
KDMAAVQRTIVALGSIAVTKNDGQYKGDPSWFMKKAQEHKRDFSDEKLKEGKNIIGLQMG
SNQGATQSGMTGYGRPRQIIS
Download sequence
Identical sequences Q5BKM2
8364.ENSXETP00000008136 ENSXETP00000008136 ENSXETP00000008136 NP_001025579.1.99540 gi|60688407|gb|AAH91023| gi|71896187|ref|NP_001025579|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]