SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000008492 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000008492
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 294-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000008492
Domain Number - Region: 173-227
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000654
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000008492   Gene: ENSXETG00000003911   Transcript: ENSXETT00000008492
Sequence length 524
Comment pep:known scaffold:JGI_4.2:GL172642.1:6027212:6051626:1 gene:ENSXETG00000003911 transcript:ENSXETT00000008492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLEKVYFILEVLLITILVVEGIAVAQRTQEGQNIGTKHIPAPQCGTWVRTINGGHFASP
NFPNTYPPNKECVYILEAAPRQRIELTFDEPYHIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGLKSPTPIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFSYLGGILSPIPDCQFE
LSGADGIIRSSQVEQEEKLKTGQALDCIWTIKATPKAKVCNRVSLFVSIAHKTECEKRYQ
FTVEIINNFLPIKSLYCKKKCDNIHKRQNNGVSVKLNIMKASSYDLLSHSVSAAPCVGST
FFCHSNMCINNSLVCNGIQNCAYPWDENHCKEKKEAGLFEQITKTHGTVIGITSGIVLVL
LIISILVQVKQPRKKIMARKTTFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELEN
YQKTRRSSTTSRCIHDHHCGSTTASLKQSRTNLSSMDLPFRNDFAQPQPMKTFNSTFKKS
TYTFKQSHDCPEQGIEDRVMEEIPCEIYVRGREDCAQGSMSIDF
Download sequence
Identical sequences F6SWC5
ENSXETP00000008495 ENSXETP00000008492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]