SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000008551 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000008551
Domain Number 1 Region: 627-776
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-33
Family MAM domain 0.0019
Further Details:      
 
Domain Number 2 Region: 945-1109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-27
Family MAM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 779-942
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-26
Family MAM domain 0.0032
Further Details:      
 
Domain Number 4 Region: 45-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-23
Family MAM domain 0.0056
Further Details:      
 
Domain Number 5 Region: 253-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000443
Family MAM domain 0.021
Further Details:      
 
Domain Number 6 Region: 210-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 476-617
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000316
Family MAM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000008551   Gene: ENSXETG00000003945   Transcript: ENSXETT00000008551
Sequence length 1121
Comment pep:known scaffold:JGI_4.2:GL173303.1:18681:31997:1 gene:ENSXETG00000003945 transcript:ENSXETT00000008551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLWLDRCCWCNPEKLCNFVCDQWDCSDEKHCGYHKESSLLGRAFSCDFEQDDCGWTDVS
TSSYRWVRERRTFSRWGTRPHGDHTLRNRWGWFMATGGHTGKAAATASLQSPILRNAAAT
CEIHLHYHIWAPDATTINGTLSVQLTDKTQTYNLWVGPKSSVLGWRQTVIYPGRIRGQFQ
LIVVSSRDPSSQGDIAIDDLEFRHCGLSAPQLACPAGYHQCPLGPCVMPESLCDGTDDCG
DNSDESNCTGHRFCNFETDSCQWDSTAPNSWHRANGIGSKPSRDHTSANRNGEYLTAMVE
NGSSAELSLPTQPSNEPCSVVLYYLMDGSDGNRLLISSQKGNEAKKVLAERQGQRGQVWL
REKVTLQLPDPEHTDLAGAEAKVLGKIGASDLIFSPGCKLVGNAPTLTLRQRAHPIPRPT
VPPYPSANVSHPIPRPTCPTLTLGQRAHPNPRPTCPTLTLGQRAHLCGGFHFPLINAANW
TDLSIGKLKWGADNGALPGGDTRKYLGVQQAQGNLLVGAETRSPTLCAVGPTCAVKMTYY
FNSGPAGSLSLSLWDPESGAHSHIWGSQGESRPEWRSVVIPVGERKQQFQLVLVGSVEPL
PRGDWGAAVEEIQFIDCGIKQLTVDEAPVTCNFESGTCGWYQDPTDDMDWIMGAQGDHTT
GKGNFIYVDGGSRTDRGMKARLLTYAQSSAGDSQCLSFYYRVWGPDAGTLILSSIIDGKE
TLLWTGTGTHGNRWHHESVTLTIPTAGKYQLALDAVRDGSVGNMAVDDITLRPGACAAPT
RCTFEAGTCRFKSEGQYRWKLNQNQNANPSGPQPGPFFDHTLQSIAGHYMVVDTSSTALP
RRASAVLTSDTYGALPAPGCVSFWSQFGGDQSGTLNVYVVEGKKKEMRKLLSASRTHGDN
WAYRSATIHPGGTWELRFEAVGAGGDRGHVALDDIHISHHPCHEPAACDFESGFCAWSNV
RFPLVDTYDWDSTNGAGQFLKKTAINEDHTLGTKEGHYAFVDTGSLHTEGSSAWLTSEQL
PATSGSCFSFWYRTDAGDHYHAGELVLFMSSAQGLRPVWVLHGQHSNAWQEQQLQLDSTV
DFQFVFEASKGSRPHSATVALDDLKYVTGRSCDAKQEQEGE
Download sequence
Identical sequences F7A7I5
ENSXETP00000008551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]