SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000008794 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000008794
Domain Number 1 Region: 22-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-30
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 2 Region: 234-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-25
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 426-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 142-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 387-425
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 188-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 350-387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000008794   Gene: ENSXETG00000004065   Transcript: ENSXETT00000008794
Sequence length 828
Comment pep:known scaffold:JGI_4.2:GL172639.1:1956824:1967213:-1 gene:ENSXETG00000004065 transcript:ENSXETT00000008794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGNDALESADNVHVSELPVACGGIPEQIRDKSGIITSPGWPADYPARINCSWYIRASPG
EKITIRFQEFDLQGSSTCSFDWVTIGPSQNYDGARACGSTIPAPYTSLQDHVWIKFHSDE
HVSRKGFCLSYLAGKTADEKKKCESDRFRCVNGKCIPEILRCNRMDDCGDGSDEKLCAKA
NRPTLSSFQPCTVSQFQCLSRFTKAYTCLPNSLKCDGNIDCLDLGDELDCDVPSCGQSLK
YFYGAFSSPNYPDFYPPGSNCTWLIDTGDRRKVILRFTDFKLDGTGYGDYVKIYDGLEEN
PRNLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEIPCGG
NWGCYTEQQRCDGYWHCPNGRDELNCTMCQKDEFPCSRNGVCYPRSDRCNYQNHCPNGSD
EKNCYFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIGSLIC
GLLLVIALGCTCKLYSLRMFERRSFETQLSRVEADLLRREAPPSYGQLIAQGLIPPVEDF
PVCSPNQASVLENLRLAVRSQLGFTSIRLPIAGRSSNIWNRIFNFVRSSNSSSLALVSTE
GDNGASQSTGRDGDRSSSHRGRHSVESDTDTENERRDTQGAVGGVVASLPRKTPPVAAVE
ATVNANGGSSTQTSNNTTDNPRDTPSSEPSAVSPARQQLSSALSRMTQGLRWVRITLGRS
SAASQNQSPLRQLDSSGNGREEDDDVEMLIPAVDIDLSDCSRPLLDIASEQGQGNCQAHS
ARPQGIRPCSRDGPCECCGIVHTAQIPDTCLEAVLKNETSDDEALLLC
Download sequence
Identical sequences F6Y8Z8
ENSXETP00000008794 ENSXETP00000008794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]