SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000009379 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000009379
Domain Number 1 Region: 785-980
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-58
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 448-569
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.36e-36
Family Frizzled cysteine-rich domain 0.00014
Further Details:      
 
Domain Number 3 Region: 125-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-18
Family Frizzled cysteine-rich domain 0.0033
Further Details:      
 
Domain Number 4 Region: 649-688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 377-418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 297-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 339-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 574-611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 706-789
Classification Level Classification E-value
Superfamily SRCR-like 0.00000131
Family Scavenger receptor cysteine-rich (SRCR) domain 0.071
Further Details:      
 
Domain Number 10 Region: 615-647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000009379   Gene: ENSXETG00000009837   Transcript: ENSXETT00000009379
Sequence length 980
Comment pep:known scaffold:JGI_4.2:GL172695.1:500111:566718:1 gene:ENSXETG00000009837 transcript:ENSXETT00000009379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFGADEDNMGDGCSQKLASAKYLRILLLILIPCVCALILLLVVLLTFIGDLSLCFSKCA
SGPPPQKDDGTARTVQLIPENSRYGIYIDASAPSMSPKSCISSPAFTPVVKTVGPEKQGF
AIKEGACINITYNQCQHLPYNYTVPKSVYSFVKSIEMEMFLKFFSYLNRLSCYQHIMLFG
CSLALPECYSHDDERKRTYSDSKVVCEITKENCEGLLGVMRSYKDHSMYCITNGVYYRNG
PAPPPNCLYILVIHSRVSLSNSITNILCISVVCGPQRIPSSQYADCEKTKDHFYLLTDCS
EHLFRCNTGKCLNHSFVCDGYDDCGDLSDEQNCGCNPLESYRCGDGRCITLSWVCDGDHD
CADKSDEVNCSCHSQGLTECKNGQCIPSAFRCDGDSDCKDGSDEENCPEIKGKCKEGNQI
CTINIYIYFCLKMVLKSCNVFLFMMFSGQCEPITLELCINLPYNYTTFPNYLGHRTQKEA
SISWESSLFPALVQTNCYKYLMYFACTILVPKCEPETHQRIPPCRSLCEHSKERCESVLG
IVGLQWPEDTDCTQFPDEKSDNQTCLTPDEDVEECSPSHYKCRSGRCILASRRCDGEADC
EDDSDEENCECAERGLWECPVNKMCIKHSMICDGFPDCPEELEEKNCSSCTSEELECANH
ECVSRDRWCDGLIDCTDGSDEWNCVTLSKSVSSLTFLTIHRSASDYHVCADDWEEELTQW
VCNQLGLGGPSITAEATELDHFGHNEWLHLKEDWKKQNGSTFHELLIKGRQPCESRRKVS
LLCTKEDCGRRPAARMSKRILGGRTSRPGRWPWQCSLQSDPSGHICGCVLIGKKWVLTVA
HCFEGRESAAVWKVVFGINNLDHPSDFAQTRLVKKIILHPRYNRAVVDYDISIVELNEDI
TETSYVRPVCLPTKGQLVEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLERCQSYFDMK
TITSRMLCAGYESGTIDSCM
Download sequence
Identical sequences F6PR30
ENSXETP00000009379 ENSXETP00000009379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]