SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000009493 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000009493
Domain Number 1 Region: 274-561
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-43
Family Kelch motif 0.005
Further Details:      
 
Domain Number 2 Region: 695-840
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 41-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 972-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000009493
Domain Number - Region: 896-931
Classification Level Classification E-value
Superfamily Plexin repeat 0.000785
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number - Region: 11-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00854
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 613-645
Classification Level Classification E-value
Superfamily Plexin repeat 0.0575
Family Plexin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000009493   Gene: ENSXETG00000004357   Transcript: ENSXETT00000009493
Sequence length 1337
Comment pep:known scaffold:JGI_4.2:GL172841.1:339599:420942:1 gene:ENSXETG00000004357 transcript:ENSXETT00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTRISGTAGKECEKPCVNGMCQPSTGQCACDPGWTGEQCQHCGGRFMLTGPSGFVTDG
PGNYKYKTKCTWLIEGSENTVLRLRFNHFATECSWDHLYVYDGDSIYAPLVAAFSGLIVP
EQESNNSVPEVAITSGYALLHFFSDAAYNLTGFNISYNVDACPNNCSGRGDCTQNPDGNV
YCDCAEHWKGEACDIPYCLDNCGFPTHGICDFNNTKSCICRDGWQGPSCDVSIPANESFW
VREENLHPKLARASHRAVVVDDVMWIVGGYMFNHSDYQMVMAYDLPSHKWLSLNNSVNSV
VVRYGHSLAPYKDKLYMYGGKIDATGNVTNQLYVFHIHNQSWVQILPKAKDQYAVVGHSA
HIVTLKDGSVVMLVFFGHCPLYGYISSIQQYSLDTNLWEIVQTHGALVQGGYGHSSVYDE
KSRSIYIHGGYKAFTANKYRLADDLYRYSVDNQTWMILKDSQSFRYLHTAVIISGTMLVF
GGNTHNDTSMSHGAKCFSSDFMAYDFACDYWSVLPHPMFQYDVSVDRFGHSAVLRNGTMY
VFGGFNSLLLSDVLTFTPRSCETYKSENACMVAEPGIRCVWNASLSLCSSWENATPEQEE
LISCPNKTIADNEKCDQYTDCFSCTVNSHGCQWCNDHCISLNSNCTVLQGAISVYEQCPK
NNPGFYCNKKTSCKSCAMDQNCQWEPKNQECIGLPENICGANWHLVGSSCFRITSAKDNY
DNAKLACRNQNAYLASLTSQKEVEFVIKHLQRLQIPQIIPKTDLTPWVGLRKINVSYWCW
EDMSPFSNTTLQWQQGEPSDAGFCGYLAEPSVGGLKAATCIHQINGSVCERPANYSAKQC
RTPCASRGSCGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSTCPPENCSG
YRTCAQCLEHPGCGWCTDPSNTGKGQCMEGSHRGPMKMPNSSHVTNTTPVLNVSMCPAEQ
YYNESFIMCPACQCNGHSKCVNESICEKCENLTTGKNCESCISGFYGDPTNGGSCQPCKC
NGHASMCNTNTGKCFCTTKGVKGEECQLCEVENRYQGNPLKGTCYYSLLIDYQFTFSLSQ
EDDRYYTAINFVATPEEQNRDLDMFINASKNFNLNITWATSFTAGTQAGEEIPIISKTNI
KEYKDSFSNEKFDFHNNPNITFFVYVSNFTWPIKIQVAFYRHTHRIALPAILLCYFSCFL
SLLLVAAVVWKIKQSCWASRRREVRLREDGSKTFFEYKLLIKTSQAQPIDIDFCFLIKTV
PKPIALEPCCGNKAAVLSIFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPLAYKEKSG
AARNRKHQPPAQPGTCI
Download sequence
Identical sequences F6QBN7
ENSXETP00000009493 ENSXETP00000009493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]